KEGG   Sulfolobus solfataricus P2: SSO0394Help
Entry
SSO0394           CDS       T00054                                 

Definition
ATP-dependent helicase
Orthology
K03724  
ATP-dependent helicase Lhr and Lhr-like helicase [EC:3.6.4.-]
Organism
sso  Sulfolobus solfataricus P2
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(343869..346610)
Genome map
AA seq 913 aa AA seqDB search
MINVTNEFLVRLKKLGYEDLTPIQKIAIPKVLSGKNVLIIAPTGYGKTEAAILPIFYTIF
KDKPEKISTLYITPLRALNRDLELRLRRLGEAFNISVNVRHGDSSQKERKEILDNPPDVL
LVTPETLLYLVLNDTFRKYFTNLKWIIIDELQEMLDEKRGIELSVLIQRIKKIATRNKIQ
LIGISATIGDVEIAKRYLDREGEVEIANINAIKDIKVDLILPKVEKKDADLAVKLGLRPD
TIARLEKLNEIIKNNKPIIIFTNTRETSEFIANQLMSNYSLKIASHHGSLSREIRIKTEN
DFKNGNIDAIVATSSLELGIDIGRINLVVQYMSPRQVIRLIQRVGRSGHKIGRTSIGYVI
PSEDLFDILECRAIIEALYSGYLEKPLFEENPLDVAAHEIAGMVLEGYKNPKEMMEILRN
SFYFENFTDEMFENVIELLESAKIVKRREDGSLFPSRRIWKYYYTTNMIPDSIRSYIVID
HATNMKIGTLDEDFVVTLDEDSVFILGSRLWKVVSIENDRIFVERAELKNGILPSWFGES
IPVEKEIARKVYEYIYAVEKEKRETEDNSLAEVVREYMKRGYPELRPDLILVEIVKNNLI
IVHSPFGSRGNNTLGAIISVMLDVEKQTKTTYRADPYHIAISSVLPITKNDMEKIVSTLN
STPIDRIIEILKKGIKESPQFKWKLLVEIKRFGMIDPEKEITLTSSIIKAYGDTIIGEEA
VKELLVKNYDVEIIKELKNYNWKIVEVYEASPLAKQFLDKILNYTSFDKEEKPLMIEIFK
KRLENKELKLICLSCGWEGKYSIINSPSKCPKCSSIFLTATNPDDSDSVKIVRKAIKGEK
LTSKERRQLEDLKRVASFFPDYGKYSLIALATNGVGPSNLGKVLSKLNEGENEFYMALID
EEKRFIRTRKYWH
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
atgataaatgtaaccaatgaattcttggtaagactgaagaaacttggctatgaagattta
acgccaatccaaaaaatagcaataccaaaagtactatctggaaagaatgttttaatcata
gcaccaacggggtatggcaaaactgaggcagcgatattaccaattttttatactatcttt
aaagataaacctgaaaaaatctcaacactctatataactcccttaagagcgctaaataga
gaccttgagttaaggttaagaaggctaggtgaagcctttaatattagtgttaacgtaaga
cacggagattcctctcagaaagaaaggaaggaaattttggataaccctcctgacgtatta
ttagtaacgccagaaacgttactttacttagtgctaaacgatacttttaggaagtacttt
accaatctgaaatggataataatagatgaattacaagaaatgttagatgagaaaagagga
atagaactctctgtactaatccaaaggatcaaaaaaatagcaacaagaaataaaattcaa
ttaataggaatttcagctactattggtgatgttgaaatagcaaaaaggtacttagataga
gagggagaggtcgaaatagcgaatatcaacgcaataaaggatataaaagtggatttaata
ctccctaaggttgaaaagaaagatgcggatttagcagtaaagttgggattaagaccagat
acaattgcgagacttgagaaacttaacgaaattataaaaaacaacaaacctattataata
tttacaaatactagggaaactagcgaattcatagcaaaccaactcatgagtaactattcc
ttaaaaatagcttctcatcacggctcattatcaagagaaattagaataaaaactgaaaac
gacttcaaaaacggtaatatagacgctatagtcgcaacctcgagcttagaattgggtatt
gatatcggtagaattaatctagttgtccaatacatgtcaccgagacaagtaattaggtta
attcaaagagtcggaagaagtggacataaaataggtagaacgtctataggttacgttata
ccctcagaggaccttttcgatattttagagtgcagagcaataattgaagcattatattct
ggttatttggaaaaacccctgtttgaagaaaacccacttgacgttgcagcacatgaaata
gcgggaatggttttagaaggttataaaaaccctaaagaaatgatggagattcttcgcaat
tcattttatttcgagaacttcaccgatgagatgttcgaaaacgttatagaattattagag
agcgcaaaaatagttaaaagaagagaagacggaagcttatttccaagtagaagaatttgg
aaatattattacactactaatatgataccagattccattagaagttatatagtaattgac
catgctaccaacatgaaaataggtaccttagacgaagatttcgtagtcacactagatgaa
gatagtgtattcattttaggaagtagactatggaaagtcgtatccatagagaacgacaga
atatttgtggaaagggctgagctaaaaaacggaatattgcctagttggttcggagaatca
attccagttgagaaagagatagctaggaaagtctacgagtatatttacgcagtggagaag
gaaaaaagggaaactgaagataatagcttagctgaagtagttagagaatacatgaaaaga
ggatatccagaactaagaccagatctaatccttgttgaaatagtaaagaataatttaata
atagtgcattcaccattcggctcaagaggaaacaacacgcttggtgccataatttcagtt
atgttagacgtagaaaaacagaccaaaacgacttatagggctgatccatatcacatcgca
atatcttctgtactgccaataactaaaaatgatatggaaaaaattgtctctacgctaaat
tctactcctatagacagaataattgaaatattaaagaagggaattaaagaaagtccgcaa
ttcaagtggaaattattggttgagataaagaggtttgggatgatagacccagaaaaggaa
ataacgcttacctcatccattataaaggcttatggagatacaataattggagaagaagca
gttaaggaattattagtcaaaaattatgatgtagaaataataaaggaactcaagaattac
aactggaaaatagtagaggtttacgaagcgtcccccttagctaaacaatttctagataaa
atccttaactacacctcgttcgataaagaagaaaaaccattaatgattgaaattttcaaa
aagagattagaaaacaaggagctgaaattaatctgtctctcatgtgggtgggagggaaaa
tactctataattaactcacctagcaaatgccccaaatgttcctcaattttcttaactgca
actaatccagatgatagcgattccgtgaagatagtgagaaaagcaataaaaggtgagaaa
ttaacaagtaaggagagaagacagttagaagacttgaagagagttgcctccttcttccca
gattacggtaagtacagcctaatagcattagcaactaatggagttggaccaagtaattta
ggcaaagtattgagtaaattaaatgaaggagaaaatgagttttacatggccttaatagat
gaagagaaaagatttataagaacaagaaaatactggcactaa

DBGET integrated database retrieval system