KEGG   Sulfolobus solfataricus P2: SSO0472Help
Entry
SSO0472           CDS       T00054                                 

Gene name
adh-1
Definition
zinc-containing alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K14465  
succinate semialdehyde reductase (NADPH) [EC:1.1.1.-]
Organism
sso  Sulfolobus solfataricus P2
Pathway
Carbon fixation pathways in prokaryotes
Microbial metabolism in diverse environments
Carbon metabolism
Module
Dicarboxylate-hydroxybutyrate cycle
Hydroxypropionate-hydroxybutylate cycle
Brite
KEGG Orthology (KO) [BR:sso00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SSO0472 (adh-1)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    SSO0472 (adh-1)
Enzymes [BR:sso01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     SSO0472 (adh-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(406507..407622)
Genome map
AA seq 371 aa AA seqDB search
MIILYLILMKGAILYKYNEPLIIEDNIQIDEPKVGETKIRIEATGLCHSDVNVFEGKTPV
PPPVIAGHEIAGVIEEVGNNVTDFKPGDRVISAFIHPCGKCKNCITGKENLCEVFAKNRL
NGTLLDGTTRLHFKDGTPIRAFLGGGFAEYAMVPYTALTKVPEDLDLRKVAVLGCAGLTA
YGAVNSAKIEPGETVAVIGVGGVGLSVIQMLKIAGAGRIIAVGTRKWKLEKALELGASDV
VNSKETDVVRAVKNITGGGPDVVIEVAGTTETVKMSLDMVRIGGKVVLVGLPPTTAEIPI
RIASIVRGGIKIIGDYGGRPRVDMPRLIELVKLGKYDPTALVTGKFRLEEINEAVKLLEQ
GEAIRSLIIPN
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgattatactgtaccttatactaatgaaaggagcaatattgtataaatataatgagcca
ttaattattgaggataatattcaaatagatgaacctaaggtaggtgaaacaaagattaga
attgaggcaactggcttatgtcattcagatgtaaatgtatttgaaggaaaaactccagtc
cctccaccagtcattgcgggacatgaaatagctggtgttatagaggaggtaggaaataac
gttacagactttaaacctggcgatagggttatatcagcatttattcatccctgcggtaaa
tgcaaaaattgtataacgggaaaggagaatttatgtgaagtctttgcgaaaaatagacta
aatgggacattactagatggtacaactagattacactttaaggatggaactccgataagg
gcatttttaggaggaggatttgcagaatacgcaatggtaccttatactgcattaactaaa
gttccggaagatttggatttaagaaaggttgcagtattgggttgtgcaggtttaactgct
tatggtgctgtaaattccgctaaaatagagcctggtgaaacagttgctgtaattggagtt
ggcggtgtaggattgtctgtgatacagatgttaaagattgctggtgccggaaggataata
gcagtcgggactagaaaatggaaattggaaaaggcgttagagctaggagctagtgatgta
gttaactctaaagagactgatgttgttagagctgttaagaatattactggaggagggccg
gatgttgtaatagaagtagcaggaactacggaaacagtgaaaatgtctttagatatggtt
agaataggaggaaaggtagtactagtgggattacctccaactactgctgaaattccaatt
aggatagcaagtatagttagagggggtattaaaatcataggagactatggagggaggcct
agagtagatatgcctagacttattgaacttgtaaaattgggaaaatatgaccctactgcg
ttagtgactggaaagttcagattagaagaaattaacgaggcagtaaaattattggagcaa
ggagaggcaataagaagtttaataattcctaactaa

DBGET integrated database retrieval system