KEGG   Sulfolobus solfataricus P2: SSO0472Help
Entry
SSO0472           CDS       T00054                                 

Gene name
adh-1
Definition
zinc-containing alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K14465  
succinate semialdehyde reductase (NADPH) [EC:1.1.1.-]
Organism
sso  Sulfolobus solfataricus P2
Pathway
Carbon fixation pathways in prokaryotes
Microbial metabolism in diverse environments
Carbon metabolism
Module
Dicarboxylate-hydroxybutyrate cycle
Hydroxypropionate-hydroxybutylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:sso01200]
Metabolism; Energy metabolism; Carbon fixation pathways in prokaryotes [PATH:sso00720]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(406507..407622)
Genome map
AA seq 371 aa AA seqDB search
MIILYLILMKGAILYKYNEPLIIEDNIQIDEPKVGETKIRIEATGLCHSDVNVFEGKTPV
PPPVIAGHEIAGVIEEVGNNVTDFKPGDRVISAFIHPCGKCKNCITGKENLCEVFAKNRL
NGTLLDGTTRLHFKDGTPIRAFLGGGFAEYAMVPYTALTKVPEDLDLRKVAVLGCAGLTA
YGAVNSAKIEPGETVAVIGVGGVGLSVIQMLKIAGAGRIIAVGTRKWKLEKALELGASDV
VNSKETDVVRAVKNITGGGPDVVIEVAGTTETVKMSLDMVRIGGKVVLVGLPPTTAEIPI
RIASIVRGGIKIIGDYGGRPRVDMPRLIELVKLGKYDPTALVTGKFRLEEINEAVKLLEQ
GEAIRSLIIPN
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgattatactgtaccttatactaatgaaaggagcaatattgtataaatataatgagcca
ttaattattgaggataatattcaaatagatgaacctaaggtaggtgaaacaaagattaga
attgaggcaactggcttatgtcattcagatgtaaatgtatttgaaggaaaaactccagtc
cctccaccagtcattgcgggacatgaaatagctggtgttatagaggaggtaggaaataac
gttacagactttaaacctggcgatagggttatatcagcatttattcatccctgcggtaaa
tgcaaaaattgtataacgggaaaggagaatttatgtgaagtctttgcgaaaaatagacta
aatgggacattactagatggtacaactagattacactttaaggatggaactccgataagg
gcatttttaggaggaggatttgcagaatacgcaatggtaccttatactgcattaactaaa
gttccggaagatttggatttaagaaaggttgcagtattgggttgtgcaggtttaactgct
tatggtgctgtaaattccgctaaaatagagcctggtgaaacagttgctgtaattggagtt
ggcggtgtaggattgtctgtgatacagatgttaaagattgctggtgccggaaggataata
gcagtcgggactagaaaatggaaattggaaaaggcgttagagctaggagctagtgatgta
gttaactctaaagagactgatgttgttagagctgttaagaatattactggaggagggccg
gatgttgtaatagaagtagcaggaactacggaaacagtgaaaatgtctttagatatggtt
agaataggaggaaaggtagtactagtgggattacctccaactactgctgaaattccaatt
aggatagcaagtatagttagagggggtattaaaatcataggagactatggagggaggcct
agagtagatatgcctagacttattgaacttgtaaaattgggaaaatatgaccctactgcg
ttagtgactggaaagttcagattagaagaaattaacgaggcagtaaaattattggagcaa
ggagaggcaataagaagtttaataattcctaactaa

DBGET integrated database retrieval system