KEGG   Sulfolobus solfataricus P2: SSO0764Help
Entry
SSO0764           CDS       T00054                                 

Gene name
adh-2
Definition
(GenBank) Alcohol dehydrogenase (Zn containing) (adh-2)
  KO
K15020  acryloyl-coenzyme A reductase [EC:1.3.1.84]
Organism
sso  Sulfolobus solfataricus P2
Pathway
sso00720  Carbon fixation pathways in prokaryotes
sso01120  Microbial metabolism in diverse environments
sso01200  Carbon metabolism
Module
sso_M00375  Hydroxypropionate-hydroxybutylate cycle
Brite
KEGG Orthology (KO) [BR:sso00001]
 Metabolism
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    SSO0764 (adh-2)
Enzymes [BR:sso01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.84  acrylyl-CoA reductase (NADPH)
     SSO0764 (adh-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C CMAS SIS_2 ELFV_dehydrog adh_short Epimerase Eno-Rase_NADH_b NAD_binding_10 E1-N 2-Hacid_dh_C THF_DHG_CYH_C
Motif
Other DBs
NCBI-ProteinID: AAK41061
UniProt: Q7LXK1
Position
complement(649487..650488)
Genome map
AA seq 333 aa AA seqDB search
MKAVVVPGKQKGYRIEEVSDPIPGKDEVVIRVNRAALCYRDLLQLQGFYPRMKYPVILGH
EVVGTIEQIGENAKGFKEGDKVISLLYAPDGTCHYCQMGEEAYCHSRVGYSEELDGFFAE
KAKVKVTSIVKVGTNVPDEGAVLVPCVTGMVYRSLRRAKLQKGETVLVTGASGGVGIHAI
QVAKALGAKVIGVTTSEEKAAFIRKFADHVIVGSKFSEEAKKIGDVNVVIDTVGTPTIDE
SLKSLWMGGRLVQIGNVDPTQIYQLRLGYVILKDIAIIGHASATKRDAEETLKLTGEGKI
NPVIAATVGLDEIDKGYEILKDKHKIGKVLVKP
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgtagtagttccgggcaagcaaaaagggtatagaatagaagaagtttcggat
ccgattccaggaaaagatgaagttgtaattagagtaaatagagcggcactctgctataga
gatctattgcaactgcaaggtttctatcccagaatgaaatatccagtaattttaggacat
gaagtagttggtacgatagaacaaattggagaaaacgccaaaggctttaaagaaggtgat
aaggttatttcacttctttatgcacctgatggaacttgtcattattgtcaaatgggtgag
gaagcatattgtcactctagggtaggttattcagaggaattagacggcttctttgctgaa
aaagcaaaagtaaaagttacaagcatagtaaaagttggcactaacgttccagacgaggga
gcagttttagtaccttgtgtaactggaatggtctatagaagtttgagaagggcaaagttg
caaaagggggaaacagttttagttacgggggctagcggtggtgttggtattcatgccata
caagtagctaaagcacttggcgcgaaagtgataggagtaactacatcagaggaaaaagca
gctttcataaggaaattcgctgatcatgtaatagtaggtagtaaattctcagaagaggca
aagaagataggtgatgtaaatgtggttatcgatacagtaggtacaccaaccatagatgaa
agtctgaaaagtttgtggatgggaggtagactggtacaaataggtaacgtagatccaact
caaatatatcaactaaggttaggctacgtcatattgaaagatatagcgataataggtcat
gcctctgcaactaagagggatgcagaagaaactctcaagttaactggagaagggaaaata
aatcccgtaatagcagcaacagtagggttagatgagatagataagggatatgaaatacta
aaggataagcataagattgggaaggtactagtaaagccttaa

DBGET integrated database retrieval system