KEGG   Sulfolobus solfataricus P2: SSO0842Help
Entry
SSO0842           CDS       T00054                                 

Definition
transposase ISC1476
Orthology
K07496  
putative transposase
Organism
sso  Sulfolobus solfataricus P2
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
722533..723915
Genome map
AA seq 460 aa AA seqDB search
MPSSGQLYGDEERELTPTPAIPEEGVYEVKYSNRRTNVVRLLPNGFQERKLRRLANLSAK
LFNEVNFERRQQFFHEGKVNIEETYKKYYEKYKVILGVNAQAVLNKNNEAWSSFFSLLKL
KKEGKLPPHMNHVSPPGYWKDREAGKRKQILVIRQDRYKVDAENHKLILKDFDMEIDFIG
RLKWYGKQGRLEIIFDETRNAWYAHIPIEVGVEETKAGKKSKHVVKGERKSIQISKPKGN
KVASIDLGINVIASVVVNDGTWLLYKGVRTKEDYFYFQKRIAEVQSLADRTRNIGEYDAY
LELLREKRRLFKKLTRRLTHLYRNLASHLIETLYELGVSTIYLGYPFNIVQEKGNKFTVN
MWSYRKLMESIELKAQEYGMKVFEVVEYNTSKYCAYHDVEVKRNPRGVINCPLGHKLHSD
LNGALNILKKALGVIVNAVKKPLSFIVDHNRVAPIKGCNP
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgccctcctctggtcaactttatggggatgaggagcgggagctaactcctactcccgca
ataccggaggagggtgtctacgaagttaaatactcaaatcgaagaaccaatgtagttcgt
cttcttccaaatggttttcaagagaggaagttgaggaggttagctaatctctctgcaaaa
ctcttcaacgaagttaacttcgaaaggaggcaacaattctttcacgaagggaaagtaaac
attgaggaaacatataaaaaatattatgagaagtataaggtcatactgggcgttaatgct
caagctgttctcaataagaataatgaagcgtggtcatccttcttctccttgttaaaactg
aagaaggagggaaaactaccaccacacatgaaccacgtttctccacccggatattggaag
gacagagaagcagggaaaagaaagcaaatactagttattagacaggaccgttacaaggta
gatgctgaaaaccacaaattaatcctcaaggatttcgacatggagatagacttcattggt
agactaaaatggtatggtaaacaaggtagactagaaataatttttgacgaaaccagaaac
gcttggtatgcgcacataccaattgaagtaggtgttgaggaaacaaaggctggaaagaag
agtaagcacgtcgtcaagggtgagagaaagtccatccagatttccaaaccaaagggaaac
aaagtagcttcaatcgatctaggcatcaacgtaatagctagcgtagtagttaacgatggc
acctggttgttgtataagggtgttagaacaaaggaggactacttctacttccaaaagaga
attgcagaagtgcaatcgttagctgacagaaccagaaacattggtgaatatgatgcgtac
ctagaattgttgagggaaaagaggaggttgtttaagaaactaactaggaggctcactcat
ctatatcgtaacttagcttcccaccttattgaaacactctacgaactaggagtgtcaaca
atttatctaggttacccattcaatatcgtgcaagaaaaaggcaataagtttacagtgaac
atgtggtcttatcgtaagttaatggaatccattgaattgaaagcacaagaatatggtatg
aaggtgtttgaggttgttgagtataatacgtccaagtactgtgcttatcatgatgtggaa
gtaaagaggaacccaagaggtgttatcaactgtcctttaggtcataaacttcacagcgat
ttgaatggtgcgttaaacattctaaagaaggcattaggagtaatcgttaacgcagtgaaa
aaaccattatccttcattgtggatcataaccgagtagcacccataaaggggtgtaaccct
taa

DBGET integrated database retrieval system