KEGG   Sulfolobus solfataricus P2: SSO0965Help
Entry
SSO0965           CDS       T00054                                 

Definition
ATP-dependent helicase
Orthology
K03724  
ATP-dependent helicase Lhr and Lhr-like helicase [EC:3.6.4.-]
Organism
sso  Sulfolobus solfataricus P2
Brite
Enzymes [BR:sso01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     SSO0965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(820990..823791)
Genome map
AA seq 933 aa AA seqDB search
MLDHLDQRLRKLIEEKNWMKLTRVQEMSFEPISNGYNTLVIAPTGYGKTEAALLPILNRM
LKEDVKPVTVIYITPLKALINDLLYRIDWWASRLGFLVNRKHGEVPQKEKNLRLKRIPHI
IVTTPEGLEIDLDWASRFREHYKNVKWVVVDEIHELINSKRGTQLSILLERLKYFIGYDF
QRIGLSATVSDEDKVAQFLFGSSERKMKIIRLNDTRNFEIKINKLGNDNSFALWKSAAEK
INQLIEKPTLVFTNSRFSTERLHEELEKLGNKEIYVHHSSVSRDLKNLAEGELRNGNAKA
VVCTKTLELGIHVGDIKKVIMLRPPTSVSSFLQRLGRSGHIVHGVPKGEIICFYDFDVLE
SLALYLSAKDGKMEKPFIDDGLDVVAREIVGMILQNQKMSIEEIFNIIRGTYIYRNLELS
KLLDLVNYLVKNNIIKIEENYLKLGQGFFKIWRFNRDAKNSWGKDFSEFFSLINNDETFS
LKHNGITVGEIDAVYVYKHVRANDIIRISGKFWKVLRINMHKNTIDVTPANEGEGEIPIW
KGENMSKSPLIVNYIRKIMENFNEYYLTMNEIMDKNSKESIIKIFENYRKLGLKIPSRDV
ILVENKEDEWLYTVVIDERISNTLSHILLYLVTKKYTLNASSRSSIYGFSIKGTPVDLFK
DIINMNDRKIIKIILRSILRSPLYIATLKEIQPSFGKISKINTKEDKFLIKEALRQTIKR
YFTIKKTLEFIRRVREGKIKIVYTENAGSLREAIFAHAQIRPWLSDLNLTIYQALKGGAY
TVNELSEILGISAKSLENKLKQLRRNNNKYKVTSFIDVDSRETRWCLYEDFIDIVKSEEY
YSSFSPLNNNEIFAVDLKSGDNQVEILLKPYDLINNPEEILRKIPFNNIEEAKVREAIDT
SYQFLQKYYHVGKDIIVYLLLNAIAYLQSLKYS
NT seq 2802 nt NT seq  +upstreamnt  +downstreamnt
atgctagatcatcttgaccagcgattaagaaagctgatagaggaaaaaaattggatgaag
ttaactagagtacaagaaatgtcgtttgaaccaataagtaatggttacaatacgctagtc
attgcacctactggttatggaaagactgaagctgcgttgcttccgatcttaaatagaatg
ttgaaagaagacgttaaacctgtcactgtaatttatattacgcccttgaaagcactaatt
aatgaccttctttataggatagactggtgggcctccagactaggttttttagtaaataga
aaacacggagaagttcctcaaaaggaaaagaacttaagattaaagagaataccccatata
attgtcactacgccagagggattagaaatagatctagactgggcaagtagatttagggaa
cattataaaaatgtcaaatgggtcgtagttgacgagattcacgaattaataaactcgaag
cgaggaactcagttatcaatattacttgaaagattaaaatactttattggttacgatttt
caacgaattggattatcagctacagtgagtgatgaggacaaagtagctcaattcctcttc
ggatcttccgaaagaaagatgaaaataataagattaaatgatacgaggaattttgaaata
aaaataaataaacttggtaatgataatagttttgctttatggaagagtgcagcagaaaaa
ataaatcaactaatagaaaaaccaacactagtctttacaaattctaggttttccacagaa
agacttcatgaagagttagaaaaattagggaataaagaaatctacgtgcatcattcgtca
gtttctagagatcttaagaacttagctgaaggagaattaagaaatggtaatgcgaaggca
gtagtatgcactaagacactagaactaggaattcacgtaggagatataaagaaagtaata
atgctaagaccgccaacttcagtatcctcatttttacagagattaggtagaagtggacat
atagttcatggagttcctaagggagaaataatctgcttctatgatttcgacgtattagag
tctttagcgctgtatctctcagcgaaagatggtaaaatggaaaaacctttcatagatgat
ggattagatgttgttgctagagaaatagtaggcatgatactgcaaaatcagaagatgagt
atagaagagatttttaatataattcggggtacctatatttataggaatctagaattatca
aaactattagatttagttaattacttggtcaagaataatataataaaaatagaggaaaac
tacttgaaactaggtcaagggttctttaagatatggagatttaatagagatgctaaaaac
agctggggaaaggacttctcagaattcttctcattgatcaacaacgacgaaaccttttcc
ttaaaacataatggtataaccgtaggtgagatagatgcagtttacgtatataagcatgtg
agagcaaatgatataataagaataagcggaaagttctggaaagtattacgtataaatatg
cataaaaatacgatagatgttactccagcaaatgaaggtgaaggtgagatacctatatgg
aaaggagaaaatatgtccaaatctccactaatagtgaattatattagaaagattatggaa
aatttcaatgaatattatcttacaatgaatgagattatggacaaaaactcaaaggaaagc
ataatcaagatattcgagaactatagaaagttaggactgaaaataccctctagagatgtt
atactggtagaaaacaaggaagatgaatggctttacactgtagttattgatgagaggatt
tcaaatactttatctcatatattactttatttagttactaaaaagtatacgttaaacgct
tctagtagaagttcaatatatggtttttcgataaagggcactccagtagatttattcaaa
gacattatcaatatgaatgatagaaaaatcataaaaattatattaagatctatattaaga
tcacctctatacatagcgacacttaaggagatccaaccaagttttggtaaaatatcaaaa
attaacacaaaagaggataaattcttgataaaagaagcgctaagacagaccataaaaaga
tactttaccataaagaaaactctagaatttatcagaagagttagggaaggtaaaataaaa
atagtgtatactgagaacgcagggtcgttgagagaagcgatattcgctcatgcacagata
aggccttggctctctgatctaaatttaacaatatatcaagcgctaaaaggtggtgcgtat
acagttaatgagctatcggagattttaggaatctcagctaaaagtcttgaaaataagtta
aaacagcttagaagaaataataataaatataaagtaacatcatttatagatgttgatagt
agggaaactagatggtgcttgtacgaagattttattgacattgttaaatctgaagaatac
tattcctccttctcgccattaaataataatgagatctttgcagtcgaccttaagtcagga
gataatcaagtagaaatcttgttgaaaccatacgatttaattaataacccagaagagatc
ttaaggaagattccattcaataatatagaggaggctaaggttagggaagctatagatact
tcctatcaatttctacaaaagtattatcatgtaggtaaagacattatagtatacttattg
ctcaatgctattgcttatctacaaagtttaaaatactcttaa

DBGET integrated database retrieval system