KEGG   Sulfolobus solfataricus P2: SSO1187Help
Entry
SSO1187           CDS       T00054                                 

Definition
transposase ISC1316
Orthology
K07496  
putative transposase
Organism
sso  Sulfolobus solfataricus P2
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1030272..1031453
Genome map
AA seq 393 aa AA seqDB search
MPTLGFRFRAYTDEQTLRALKAQLKLTCEIYNTLRWADIYFYQRDGKGLTQTELRQLALD
LRKQDDEYKQLYSQVVQQVADRYSEAKKRFFEGLARFPKEKKPHKYYSLVYTQSGWKILH
VREIRKGKKNKKKLITLKLSNLGTFKVIVHRDFPLDKVKRVVVKLTRSERIYITFVVDHE
FPKLPNTGKVVAIDVGVEKLLITSDGEYFPNLRPYEKALWKVKHIHRELSRKKFLSNNWF
KAKVKLARAYEHLKNLRTDLYMKLGKWFAEHYDVVVMEGIHAKQLVGKSLRSLRRRLSDV
GFGELRGVLKYQLEKYGKKLILVNPAYTSKTCARCGYVKNDLSLSDRVFVCPNCGWIADR
DYNASLNILRGSGSERPLVWSSALYQYSGKVGL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgcccaccttagggtttcgcttccgtgcatacactgacgaacaaacccttagggcgtta
aaagcccagttgaagttaacatgtgaaatctacaacaccttaaggtgggcagacatatac
ttttaccaaagggatgggaaaggacttacgcagactgagttaagacagttggctctagat
ctgagaaaacaagatgatgagtataagcaactctactcgcaagtggttcaacaagtagct
gaccgttattccgaagctaagaagaggttttttgaaggtttagcacgtttcccaaaagaa
aagaaacctcataaatactactcccttgtctatacgcaaagcggttggaaaatacttcac
gttagagaaataagaaaaggcaagaagaataagaagaaactaataacgcttaaactatca
aatcttggtacgttcaaggtaatagttcaccgagactttccccttgacaaagtaaagagg
gtagtagtgaagctaacaagatctgagaggatttacatcactttcgtagttgatcacgaa
ttccccaagttacctaacacgggtaaggtagtggcgatagatgttggtgtagaaaagttg
ttaataacgtcggatggtgagtattttcctaatttgagaccttacgagaaagcgttatgg
aaagtgaagcatatacacagagaactttcaaggaagaagttcctctctaataattggttt
aaggctaaggttaagcttgctagggcttatgagcatttgaagaatctaagaacggatctt
tacatgaagttgggcaagtggtttgctgagcattatgacgttgtggtgatggaaggtatt
cacgctaaacagcttgtgggtaagtccttgaggtctctgaggaggagattgagtgatgtg
ggatttggtgagttgaggggtgtgctgaagtatcagctggaaaaatacggtaagaaactc
atcctagttaatcctgcatacacttccaaaacttgtgctaggtgcgggtatgtgaaaaat
gacttgtctctatctgatcgtgttttcgtttgtcccaactgtggttggattgcagatcgt
gactataatgcttctcttaacatcttacgtggatcggggtcggagcgacccttagtgtgg
agctccgccctctaccagtactctggcaaggtggggctgtga

DBGET integrated database retrieval system