KEGG   Sulfolobus solfataricus P2: SSO12018Help
Entry
SSO12018          CDS       T00054                                 

Definition
hypothetical protein
Organism
sso  Sulfolobus solfataricus P2
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2879278..2879523)
Genome map
AA seq 81 aa AA seqDB search
MERRRVKVYKKGIIVIPKEIREKLGIKEGDIIELIVNGDRISIEKPLTLLDLFGIDGDEA
LEIAKEIIKERRKEVEKEIRS
NT seq 246 nt NT seq  +upstreamnt  +downstreamnt
atggaaagacgtagagtaaaggtttataaaaaaggaataatagttattcctaaagaaata
agggaaaagcttggaataaaagagggagatataatagaattaattgttaatggagatagg
ataagcatagagaaacctttgacgcttttggatctttttggaatagacggagacgaggct
ttagaaattgctaaggaaataattaaggaaaggaggaaagaagttgagaaagaaatacgt
tcttga

DBGET integrated database retrieval system