KEGG   Sulfolobus solfataricus P2: SSO1220Help
Entry
SSO1220           CDS       T00054                                 

Gene name
adh-3
Definition
zinc-containing alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
sso  Sulfolobus solfataricus P2
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sso00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SSO1220 (adh-3)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSO1220 (adh-3)
  Lipid metabolism
   00071 Fatty acid degradation
    SSO1220 (adh-3)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SSO1220 (adh-3)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SSO1220 (adh-3)
   00626 Naphthalene degradation
    SSO1220 (adh-3)
Enzymes [BR:sso01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SSO1220 (adh-3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1059884..1060972
Genome map
AA seq 362 aa AA seqDB search
MMKAARLVEFQKPLKIEDLDVPKVGKGDVLLKVISCGICRSDWHLWRGDPALVAYMQWSG
GKLPITQGHEVYGEIVEVGESVTRLNKGDKVVMPASSTGDNRTCKYCMEGDSNVCEHLVI
AGYGINGCFAEYMLIPERSVIDLVKVPDGIKSEWAALSSCGFGTSWNAFTMKTNLKPSDI
VVIIGAGGMGLSGIAIANALGAKVIAIDVNERSLEKAKMLGSVETYRHSGKSEELNKIVE
DIMKKYGSVDVIYDTTGIPEAVIPFLPLLKVHGTLLLAGLMMKGKEIFPLPADLVVAREI
RIQGVLMLPAQKFDTIFKLMKEGKINLDPVIYKTISIYDVNDAYKEMSEYKNAGRIIINK
FS
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
ttgatgaaggcagctagattagtggagtttcaaaaacctcttaaaatagaggatctagat
gttcctaaagtgggaaaaggagatgtacttctgaaagtgataagctgtggaatatgcaga
tcagattggcatctatggcgtggagatcctgctttggtagcatacatgcagtggagtggt
ggtaagttaccaataactcaaggtcacgaggtttatggagaaattgtagaggttggagag
agtgtaactagattaaataagggagataaagtagttatgcctgcttcttctaccggagat
aataggacatgcaaatactgtatggaaggagattcaaatgtttgtgaacacttagtaata
gctggttatggaattaatggatgctttgccgagtacatgctaatcccagagaggtcagta
attgatctagttaaagtaccagatggaataaagtcagagtgggctgctctaagttcttgt
ggttttggaacttcatggaatgcgtttacaatgaagactaatttaaagcccagtgacata
gtggtcataatcggagcaggtggaatgggtttgagtggtatagcaatagctaacgctctt
ggagctaaagtgatagctatagacgttaacgaacgatctttagagaaagctaagatgtta
ggtagcgttgagacttatagacactctggtaagtctgaggaattgaataaaatagtagag
gatattatgaagaagtatggttcagtggacgtaatatatgatactaccggaattccagag
gctgtcattccatttttgcctctccttaaagtacatggaacattgctattagcggggctt
atgatgaaggggaaagagatttttccattgccagcagatttagtagtagcaagggaaatc
agaatacaaggagtattaatgttaccagctcaaaaattcgatacaatatttaaattaatg
aaggaaggaaagattaacctagatccggttatttacaagactataagcatctatgatgtc
aatgatgcctacaaggaaatgagcgagtacaaaaatgcaggaagaattattattaataag
tttagttaa

DBGET integrated database retrieval system