KEGG   Sulfolobus solfataricus P2: SSO1251Help
Entry
SSO1251           CDS       T00054                                 

Definition
(GenBank) Conserved hypothetical protein
  KO
K07076  
uncharacterized protein
Organism
sso  Sulfolobus solfataricus P2
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1077608..1077949)
Genome map
AA seq 113 aa AA seqDB search
MSIIEVLEENKRLRDNYIKNLNFYLDRIKEVVKNIDPSTKIILFGSYIRGNFRPDSDIDV
LIITNVSNEFDRLKIYHEVNKAIGNPNPFEIHVINEEEYVSWYSKFLDVYKEV
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgtctataatcgaggtccttgaggagaataagagattgagagataattacataaaaaat
ttaaatttctacctagatagaattaaagaagttgttaagaatattgatccaagtactaag
attattttatttggtagctacataaggggaaatttcagacctgatagtgatattgacgtt
ttaataataactaatgtaagcaatgaattcgataggttgaaaatataccatgaggttaat
aaagctataggcaatccaaatccctttgaaattcacgtgattaatgaagaagaatatgta
tcttggtattctaaatttcttgacgtatataaagaagtctaa

DBGET integrated database retrieval system