KEGG   Sulfolobus solfataricus P2: SSO1300Help
Entry
SSO1300           CDS       T00054                                 

Gene name
adh-4
Definition
zinc-containing alcohol dehydrogenase (EC:1.1.1.1)
Organism
sso  Sulfolobus solfataricus P2
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1129863..1130912)
Genome map
AA seq 349 aa AA seqDB search
MENVNMVKSKAALLKKFSEPLSIEDVNIPEPQGEEVLIRIGGAGVCRTDLRVWKGVEAKQ
GFRLPIILGHENAGTIVEVGELAKVKKGDNVVVYATWGDLTCRYCREGKFNICKNQIIPG
QTTNGGFSEYMLVKSSRWLVKLNSLSPVEAAPLADAGTTSMGAIRQALPFISKFAEPVVI
VNGIGGLAVYTIQILKALMKNITIVGISRSKKHRDFALELGADYVSEMKDAESLINKLTD
GLGASIAIDLVGTEETTYNLGKLLAQEGAIILVGMEGKRVSLEAFDTAVWNKKLLGSNYG
SLNDLEDVVRLSESGKIKPYIIKVPLDDINKAFTNLDEGRVDGRQVITP
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatgtaaatatggttaaatcaaaagcagcccttctaaagaagttctctgaacca
ttatcaatagaagacgttaacattccagaaccccaaggggaagaggtgttaataaggata
ggaggagctggagtctgtagaacagatttaagagtatggaagggagttgaagcgaagcaa
ggctttagattaccaataatactaggtcacgaaaacgctgggacaatagtggaagtcgga
gagttagcaaaggtaaagaagggagacaacgtagtagtttacgcaacatggggtgaccta
acttgcagatattgcagagaggggaagttcaacatttgtaaaaatcaaataatccccggg
caaacaacaaatggtggtttctcagagtacatgttggttaaaagctccagatggctggta
aaattaaacagcctaagcccagttgaagcagcacccttagcggatgccggtacgacctct
atgggggctataaggcaagccttgccgttcataagtaaattcgctgaaccagttgttata
gttaacggtattggagggttagccgtttacactatccaaatattaaaagcgttaatgaag
aatataactatagttggaatttctaggagtaagaagcatagggatttcgcgttagagtta
ggagcagactatgtgtcggaaatgaaagacgctgagagtctaataaacaaactcacagat
ggtttaggtgctagtattgcaatagatctggtggggactgaggaaactacttataattta
ggaaaattattagcacaagaaggtgcaataatactggtaggaatggaggggaagagagta
agtttagaagcctttgatactgcggtgtggaataagaagcttctgggttcaaattacggt
tcgctaaacgatttagaagatgtagtaaggcttagtgaaagtggaaaaattaagccatat
attattaaggtacctttagatgatattaacaaagcattcactaacttggatgagggaaga
gtagacggaagacaagtaataacaccataa

DBGET integrated database retrieval system