KEGG   Sulfolobus solfataricus P2: SSO1341Help
Entry
SSO1341           CDS       T00054                                 

Definition
transposase ISC1316
Orthology
K07496  
putative transposase
Organism
sso  Sulfolobus solfataricus P2
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1177035..1178246
Genome map
AA seq 403 aa AA seqDB search
MPTLGFRFRAYTDEQTLRALKAQLKLACKIYNTLRWADIYFYQRDGKGLTQTELRQLALD
LRKQDDEYKQLYSQVVQQIADRYYEARQRFFEGLARFPKEKKPHKYYSLVYPQYGWKILH
VREIRKGSKKKLITLKLSNLGTFKVIVHRDFPLDKVKRVVVKLTRSERIYITFVVDHEFP
KLPNTGKVVAIDVGVEKLLVTSDGEYFPNLRPYEKALWKVKHLHRELSRKKFLSNNWFKA
KVKLARAYEYLKNLRTDLYMKLGKWFAEHYDVVVMEGIHAKQLVGKSLRSLRRRLSDVGF
GELRGVLKYQLEKYGKKLILVNPAYTSKTCARCGYVKNDLSLSDRVFVCPNCGWIADRDY
NASLNILRGSGSERPLVPVELRPLPVLWQGGAMKQEAPSFMRG
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcccaccttagggtttcgcttccgtgcatacactgacgaacaaacccttagggcgtta
aaggcccagttgaagttagcgtgcaaaatctacaacaccttaaggtgggcagacatatac
ttttaccaaagggatgggaaaggacttacgcagactgagttaagacagttggctctagat
ctgagaaaacaagatgatgagtataagcaactctattctcaagtagttcaacaaatagcc
gaccgttactacgaagctagacagaggttttttgaaggtttagcacgtttcccgaaagaa
aagaaacctcacaaatactactcccttgtctatccccagtatggttggaaaatacttcac
gttagagaaataagaaaaggaagcaagaagaaactaataacgcttaaactatcaaatctt
ggtacattcaaggtaatagttcaccgagactttccccttgacaaagtaaagagggtagta
gtgaagctaacaagatctgagaggatatacatcactttcgtagttgatcacgaattcccc
aagttacctaacactggtaaggtagtggcgatagatgttggtgtagaaaagttgttagta
acgtcagatggtgagtattttcctaatttgagaccttacgagaaagcgttatggaaagtg
aagcatctacacagagaactttcaaggaagaagttcctctctaataattggtttaaggct
aaggttaagcttgctagggcttatgagtatttgaagaatctaagaacggatctttacatg
aagttgggtaaatggtttgctgagcattatgacgttgtggtgatggagggtattcacgct
aaacagcttgtgggtaagtccttgaggtctctgaggaggaggctgagtgatgtgggattt
ggtgagttgaggggtgtgctgaagtatcagctggaaaaatacggtaagaaactcatccta
gttaatcctgcatacacttccaaaacttgtgctaggtgcgggtatgtgaaaaatgacttg
tctctatctgatcgtgttttcgtttgtcccaactgtggttggattgcagatcgtgactat
aatgcttctcttaacatcttacgtggatcggggtcggagcgacccttagtgcctgtggag
ctccgccctctaccagtactctggcaaggtggggctatgaagcaggaagctccctcattt
atgagggggtag

DBGET integrated database retrieval system