KEGG   Sulfolobus solfataricus P2: SSO1381Help
Entry
SSO1381           CDS       T00054                                 

Definition
hypothetical protein
Organism
sso  Sulfolobus solfataricus P2
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1221294..1221995
Genome map
AA seq 233 aa AA seqDB search
MFLSFSPTYSKITESKEPHKPLRITVIKDHGKPLYSTGKNKIVLKTENTYTFTVNTLLED
VVKEVVKTESVNKEIYNTKFHVELENIIVKEEFKINDARFYKIHFKTPTLLQPPRPSIKR
KGNRYVLFPYVPLLFYSIASHWNRYMNNKIVGVTGSKTLYYFREVNYKIRPLTAYYGNIP
NKGFVGWVLFELKARKGSNLRENIRRLLDYANYFGIGKSRNIGFGEVDVRPLE
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
ttgttcctctccttctccccaacttactcaaagatcactgaaagcaaggaaccacacaaa
cccttaagaataaccgtaataaaagatcacggcaaacccttatattccacgggtaaaaat
aaaatagtgctaaagactgaaaacacatacacatttaccgtaaataccctattagaggat
gtggtaaaggaagtggtaaagaccgagagtgtcaataaggaaatttacaatacgaaattt
cacgttgagctggaaaacattatagtcaaagaggagtttaagattaatgatgccagattc
tacaaaattcactttaagaccccaacactcctacaacccccgagacctagtatcaaaaga
aaaggcaatagatacgtcttgttcccttacgttccactcctcttttactccatagcctcc
cattggaatagatacatgaataacaagatagttggagtaactggtagcaaaaccctatat
tattttagagaagtaaattacaagataaggcctctaaccgcatattatgggaacatacct
aataagggatttgtgggatgggttttatttgagttaaaagctaggaagggaagcaattta
agggaaaacatcagaaggctcttagattacgcaaattacttcggtataggaaaaagcaga
aatataggttttggagaagtagatgtaagacctttggaataa

DBGET integrated database retrieval system