KEGG   Sulfolobus solfataricus P2: SSO1383Help
Entry
SSO1383           CDS       T00054                                 

Definition
hypothetical protein
Organism
sso  Sulfolobus solfataricus P2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1223837..1224370
Genome map
AA seq 177 aa AA seqDB search
MESQLPKFLKEPEKYSRLRLLEALQELYLSIEMLKEGYSRNSASKLFLSWKALLSSIVVT
NFGKIMETKKKEGKEDEIKWYMRIGYSAPTTGLIGIARDLENLGFKGLVNLTTAMLGIHR
YAYNGLDEDISPFHSRSEAIISIKGLIKAEVEIVGSMKFGDEEKELFEKIKRELNNI
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atggagtcgcagttacctaaattcttaaaggaaccggagaagtactctaggttgagatta
cttgaggctctgcaagagctctatttaagcattgaaatgctcaaagaaggctatagcagg
aactccgcaagtaaattattcctctcatggaaggcgcttttaagttcaatcgttgttaca
aattttggcaaaataatggaaacgaagaagaaagaagggaaggaagacgagataaagtgg
tacatgagaataggatattctgcacctactactggtctaatagggattgcaagagacctt
gagaatctcggatttaaagggttagttaatctaacaaccgcaatgctggggattcacaga
tacgcatataacggtttagatgaggatataagtccttttcacagtaggagtgaagcaata
atatcaataaaggggttaataaaagctgaagttgaaatagtaggctcaatgaaatttggg
gatgaagagaaagagctctttgagaaaataaagagggaattgaacaacatctga

DBGET integrated database retrieval system