KEGG   Sulfolobus solfataricus P2: SSO1406Help
Entry
SSO1406           CDS       T00054                                 

Definition
hypothetical protein
Organism
sso  Sulfolobus solfataricus P2
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1253640..1254425
Genome map
AA seq 261 aa AA seqDB search
MIYTLTFRLKPSNDVIIPPFSSKLSRTLFLSFSPTYSKIIESKEPNKPLRITVVKDQGKP
LYSNGKSKVVLKAENTYTFIVNTLLEDVVKEVIRVESVNREIYNTSFHVELVNVSVKENV
MAEDARFYRVHFKTPTLLQPPRPRMKRKENRYVLFPYVPLLFYSIASHWNRYMDKKIVGV
TGSKTLYYFREVNYRIRPMTAYYGNIPNKGFVGWVVFELSARKGSKIRENIRRLLDYVNY
FGVGKSRNIGFGEVEVKSLNG
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
gtgatttacacacttacatttcgattaaaaccctcaaatgacgtaattattccacccttc
tcttctaagctcagtaggacgttattcttatccttttcccccacgtactcgaagattata
gagagcaaggagccgaacaaacccttgaggataactgttgtaaaggaccaaggcaaaccc
ttgtactcaaatgggaagagtaaagtggtgctaaaggcagagaacacctacacttttatc
gtaaacactctattggaggatgtggtaaaggaggtaataagggttgagagtgtcaatagg
gaaatttataacactagttttcacgtagagttggtgaacgtttcagtaaaggaaaacgtc
atggcagaggacgccagattttacagagttcacttcaagacgcctacgcttttacaaccc
cctaggcctaggatgaaaagaaaagagaacagatacgtgttattcccttacgttccactc
ctcttctactctatagcctcccactggaatagatatatggataagaagatcgttggagtt
actggtagtaagacgttatactactttagagaggtgaactataggataagacctatgact
gcttattacggaaacatacccaataaggggtttgtgggatgggttgtgtttgagttgagt
gctagaaaaggcagtaagataagggagaacattaggaggctattggattacgtaaattac
ttcggcgtgggaaagagtaggaacattggctttggagaggtagaagtaaaatcacttaat
ggttaa

DBGET integrated database retrieval system