KEGG   Sulfolobus solfataricus P2: SSO1419Help
Entry
SSO1419           CDS       T00054                                 

Gene name
apeH-1
Definition
acylaminoacyl peptidase (EC:3.4.19.1)
Organism
sso  Sulfolobus solfataricus P2
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1271424..1273034)
Genome map
AA seq 536 aa AA seqDB search
MKYEDLFKIKPVLDYDVYNGKIATIIRDEKPVLYVNKEKVQLEGYAKEVDWINRNKMFIT
VDPNGSEIRKIYLYDNGKIEKIIDNEFDNLSPRETNEGILVISNYDKKTLHLYLYNEGKY
IKLSKGEGPVNNYCFNGKYIVYSTGIYDNNIHVMDLSGNEINVINIPNSEQELANENCFT
SPSSFIFLSNHEDLSKVYEFNILKGEIRKIRESDYEIFEAIPYKGSIAYVEDRHGNFVLI
HEKEIVNEGFTYSLKVDGDYIYFVNSKHDRSADLYRYGKKVERLTDSMNDAKGNFIKPKV
VSYDSNGLRIYALLYEKGGEDKGIVYIHGGPDWECVNSFNPEIQFFMERGFKVICPNYRG
SIGYGRRFNHLNDKDPGGGELLDVINSVKVLGVKKIAITGASYGGYLTMMATTKFSDLWC
SAVAVVPFVNWFTEKKLEREILQLYDEIKVGNDENLLRDRSPIFFIDRIKTSLLLLAGEN
DPRCPAEETLQVVEELRKLGREVKYKIYKDEGHGFAKIENYVDSIKEAVEFITSHC
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatgaagatttatttaagataaaacctgtactcgattacgacgtatataacgga
aaaatagcaacaattataagagatgaaaaacccgtcctttacgtcaacaaggaaaaagtc
caactcgaaggatatgccaaagaagtagactggataaatagaaacaaaatgtttatcaca
gtagaccctaacggtagtgaaattaggaaaatttacctttacgataacgggaagatagag
aaaattattgataatgagtttgataatttatctcctcgcgagacaaacgaagggattcta
gtaatctcaaactatgataaaaagacattacatctttacctctacaatgaaggaaaatat
attaagctaagcaagggtgaaggaccggtaaacaattactgttttaatggcaaatacata
gtttactcgactgggatttatgataataacattcacgtgatggatctcagtggtaatgaa
attaatgtaattaatatcccaaactcagagcaagagcttgcaaatgagaattgttttact
tctccttcatcattcatctttctctcaaatcacgaggatttatctaaggtttatgagttt
aatattttaaagggagagatcagaaaaataagggaaagcgattacgaaatctttgaggct
attccatataagggttctatcgcttatgttgaggatagacacggcaactttgtcttaatt
cacgaaaaagagatagttaatgaaggctttacctactccttaaaggttgatggagattat
atttattttgtaaactctaaacatgatagatcagcagacctatacagatatgggaaaaag
gtagagaggttaactgactcaatgaacgatgctaaagggaatttcataaaacctaaggtt
gtctcttacgactccaatgggttgaggatttacgccttactctatgaaaaaggtggtgag
gataagggtatagtttatattcacggaggtccagattgggaatgcgtaaactcattcaac
ccagaaattcagttctttatggagagaggatttaaggttatttgtcccaattacagagga
tctataggttatggaaggaggtttaaccatttgaacgataaagacccaggaggaggtgag
ttgttagatgttataaattcagtgaaggtcttaggagttaaaaagattgcaataactggt
gcaagttatggtggctatttgaccatgatggctactactaagttctcggacctttggtgt
tcggctgtggctgtagtaccttttgttaattggtttaccgaaaagaagcttgaaagggaa
atacttcaactatatgacgaaataaaggttggtaatgatgaaaatttattgagggataga
tcacctatattctttattgataggataaaaacttcattgcttctcttagctggtgaaaat
gacccaagatgtccagctgaggaaactttgcaagtagttgaagaacttagaaagttgggt
agagaagtgaaatataagatatacaaagatgagggacacggatttgcaaaaatagaaaac
tatgttgactcgataaaagaggctgtggagtttattactagtcactgctga

DBGET integrated database retrieval system