KEGG   Sulfolobus solfataricus P2: SSO1429Help
Entry
SSO1429           CDS       T00054                                 

Definition
hypothetical protein
Organism
sso  Sulfolobus solfataricus P2
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1282426..1283310
Genome map
AA seq 294 aa AA seqDB search
MEIIAGYRTTSDSRYIALIKADGNNAGKIFGNTVTFSEYVDKSFRLDFGVKKMFYDTLLD
IMRASSDESIKKDLVSRILLGVLYLGGDDIMLLSPSAIAVPFAVKMFKRSLEYTGFTFKV
GIISVKPDHPVQFAYGAVNALMEESKIHTGEKSSIGVLVFSSTLASEGVVKSDLKNYRKE
KESFLVVSNDVDDVERLLNLMELDDFGKLMELYWNPEEGRKVIRDKIRSLERFVNYADTH
DFYNTLAYLIRSKAKSEENSLIKRIIDLTIKGRDDFVFPLYDYYFILKSIRVGI
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggagattattgcgggttatcgtactacttctgacagtaggtatattgccttgattaag
gctgatggaaataacgctggaaagatctttggaaataccgttacgttttcggagtatgta
gataaaagttttaggctagatttcggagtgaagaagatgttctacgatacgttactggac
attatgagggcttctagtgatgagtcaattaagaaggacttagtctcaaggatcttactt
ggtgtgctttatttgggtggagatgatataatgttattgtcgccctcagcaattgcagtg
ccatttgctgttaaaatgtttaagaggagtttagagtatacggggtttacgtttaaggtg
ggtattatatcagttaagccagatcacccagtgcagttcgcttatggggctgtaaatgcg
cttatggaagagagtaagattcatacgggtgagaagtcttcaataggcgttttggtgttt
tcttcaactttagccagtgagggtgttgttaagagcgatttgaaaaattataggaaagag
aaggagagttttttggtagtttccaatgacgttgatgatgtagagaggcttttgaatctg
atggagttggatgactttggaaagcttatggaattatattggaatcctgaggagggaaga
aaggtgattagagataagataaggtctttagaacgtttcgtaaattatgctgacactcac
gacttttacaatactttggcttacttaataaggtctaaggctaagagcgaggagaatagt
ttgattaagaggattattgatttgactataaagggtagggacgatttcgtgtttccgctt
tacgattactactttattttaaagtcaattagggtgggaatatga

DBGET integrated database retrieval system