KEGG   Sulfolobus solfataricus P2: SSO1442Help
Entry
SSO1442           CDS       T00054                                 

Definition
hypothetical protein
Organism
sso  Sulfolobus solfataricus P2
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1294537..1295502)
Genome map
AA seq 321 aa AA seqDB search
MISGSVRFLVNLESLNGVESIGNLTKHRTAPVVLKTSTGYLVRYVPVISGEALAHAYQAS
LVDIAKKEGLPVGSLSSQYEFIKFSTDEALKIEGIKEPKDYNDARRFEVEVMLKDVIADV
GGFMYAGGAPVRRTSRIKLGYMIPALRGDEIPAQLEAQFHVRFSNKPVSGSQAIFNVEVS
SALYTFSFELDEDLIAVPSTFGEKVKGEEELERQKAKRVKSAIKALYSLLSGNFGGKRSR
FLPSMKLMSLVVTKTDFPFMPEPAHDDDYIKTTIMRLGKAKGVLNGNLAKAYVINNEGIE
VGEGVTVLSTVEDLVVKLEEE
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgataagcggttcagttaggtttttggtaaatctagagtcactgaacggtgttgagagt
ataggaaatttaaccaagcacagaactgctccggttgtgttaaagacttcaactggttat
ctagtgagatatgtcccagtgatttctggggaagccttagcccatgcctatcaagcgagt
ctagtggacattgctaaaaaggaggggttaccagtaggtagtttatcttctcaatacgag
ttcataaagttctcaactgatgaggcgttaaagattgaagggataaaggagcctaaggat
tacaacgatgcgaggaggttcgaggtagaggttatgcttaaggacgttatcgctgatgtt
ggaggtttcatgtacgccggaggtgctccggtaagaaggacgtcgaggataaagttaggt
tatatgataccggctttaaggggagatgaaatacctgcacaactggaagcgcaatttcat
gtgaggttttcaaataagccagttagcggttctcaagctatcttcaacgtggaagtatcc
tctgctctctacacgttttcgtttgaacttgacgaagatttgatagcagttccatcaact
tttggggaaaaggttaaaggtgaagaggagttagagaggcaaaaggctaaaagggtgaag
tctgcaattaaagccctttactctttgctatcaggtaatttcggagggaagaggtctagg
tttttaccatccatgaagttgatgtctttagtggtgacaaagaccgatttcccattcatg
ccagaaccggcacacgatgatgattacattaagaccactattatgaggttagggaaggct
aaaggtgtgctgaacggaaatttggctaaggcgtatgtgattaacaacgaggggatagaa
gtgggtgaaggggttacagtactgtcaactgttgaggacttagtagttaaattagaggaa
gagtag

DBGET integrated database retrieval system