KEGG   Sulfolobus solfataricus P2: SSO1450Help
Entry
SSO1450           CDS       T00054                                 

Definition
(RefSeq) hypothetical protein
  KO
K15342  
CRISP-associated protein Cas1
Organism
sso  Sulfolobus solfataricus P2
Brite
DNA repair and recombination proteins [BR:sso03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Other HR factor
     SSO1450
Prokaryotic defense system [BR:sso02048]
 CRISPR-Cas system
  Universal Cas proteins
   SSO1450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1303474..1304397)
Genome map
AA seq 307 aa AA seqDB search
MISVRTLVISEYGAYVYVKKNMLVIKKGDKKVEISPSEVDEILITVSCSISTSALSLALT
HGISVMFLNSRETPWGILLPSIVTETVKTKKAQYEAIVVRKDNRYGEEIISSKIYNQSVH
LKYWARVTGTKNDYKELLDKDEPAAARVYWQNISQLLPKDIGFDGRDVDGTDQFNMALNY
SYAILYNTIFKYLVIAGLDPYLGFIHKDRPGNESLVYDFSEMFKPYIDFLLVRALRSGFR
LKVKGGLIEENSRGDLAKLIRKGMEENVKEESDHNPKTLIQAIRAHAVKLASSIREGKEY
RGFKLVM
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
gtgataagcgtgaggactttagtaatatctgaatacggtgcatatgtttacgtcaagaag
aacatgttagtgataaagaaaggtgataagaaggttgagatttcgccttctgaagtcgac
gaaatactgataactgtgtcttgttcgatttcaactagtgccctatcgttagccttaact
catggtataagcgttatgttcttgaactctagggagactccttgggggatattattacct
tctatcgtaactgagactgttaagaccaagaaggctcaatacgaggcaattgtagtaagg
aaggacaatagatacggagaggagattataagttcaaagatttacaaccaaagtgtacac
ttaaagtattgggctagggtaactggaactaagaacgattacaaggagttgttggataag
gatgaaccggctgctgctagagtgtattggcagaacatatctcaactgctacccaaggat
attggatttgacggtagagatgtggatgggactgaccaatttaatatggcattgaactac
tcttacgcaatactttataacacaattttcaaatatctggttatagctgggttagacccc
tacctaggctttatacacaaagatagacctggaaatgagagtctagtttacgatttctca
gaaatgtttaaaccatacattgacttcttattagttagggctctcagaagtggttttagg
ttaaaggttaaggggggtttaatagaggagaacagtaggggagatttggctaagttgata
aggaagggaatggaagagaacgttaaggaggagagtgatcataatccaaaaacattgata
caagcaataagggctcatgcggtaaagttggcgtcaagtataagggaggggaaggagtat
aggggtttcaagttggtgatgtga

DBGET integrated database retrieval system