KEGG   Sulfolobus solfataricus P2: SSO1450Help
Entry
SSO1450           CDS       T00054                                 

Definition
hypothetical protein
Orthology
K15342  
CRISP-associated protein Cas1
Organism
sso  Sulfolobus solfataricus P2
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1303474..1304397)
Genome map
AA seq 307 aa AA seqDB search
MISVRTLVISEYGAYVYVKKNMLVIKKGDKKVEISPSEVDEILITVSCSISTSALSLALT
HGISVMFLNSRETPWGILLPSIVTETVKTKKAQYEAIVVRKDNRYGEEIISSKIYNQSVH
LKYWARVTGTKNDYKELLDKDEPAAARVYWQNISQLLPKDIGFDGRDVDGTDQFNMALNY
SYAILYNTIFKYLVIAGLDPYLGFIHKDRPGNESLVYDFSEMFKPYIDFLLVRALRSGFR
LKVKGGLIEENSRGDLAKLIRKGMEENVKEESDHNPKTLIQAIRAHAVKLASSIREGKEY
RGFKLVM
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
gtgataagcgtgaggactttagtaatatctgaatacggtgcatatgtttacgtcaagaag
aacatgttagtgataaagaaaggtgataagaaggttgagatttcgccttctgaagtcgac
gaaatactgataactgtgtcttgttcgatttcaactagtgccctatcgttagccttaact
catggtataagcgttatgttcttgaactctagggagactccttgggggatattattacct
tctatcgtaactgagactgttaagaccaagaaggctcaatacgaggcaattgtagtaagg
aaggacaatagatacggagaggagattataagttcaaagatttacaaccaaagtgtacac
ttaaagtattgggctagggtaactggaactaagaacgattacaaggagttgttggataag
gatgaaccggctgctgctagagtgtattggcagaacatatctcaactgctacccaaggat
attggatttgacggtagagatgtggatgggactgaccaatttaatatggcattgaactac
tcttacgcaatactttataacacaattttcaaatatctggttatagctgggttagacccc
tacctaggctttatacacaaagatagacctggaaatgagagtctagtttacgatttctca
gaaatgtttaaaccatacattgacttcttattagttagggctctcagaagtggttttagg
ttaaaggttaaggggggtttaatagaggagaacagtaggggagatttggctaagttgata
aggaagggaatggaagagaacgttaaggaggagagtgatcataatccaaaaacattgata
caagcaataagggctcatgcggtaaagttggcgtcaagtataagggaggggaaggagtat
aggggtttcaagttggtgatgtga

DBGET integrated database retrieval system