KEGG   Sulfolobus solfataricus P2: SSO1475Help
Entry
SSO1475           CDS       T00054                                 

Definition
transposase ISC1476
Orthology
K07496  
putative transposase
Organism
sso  Sulfolobus solfataricus P2
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1335113..1336363
Genome map
AA seq 416 aa AA seqDB search
MKRSNTVRLVVSKEQHEVLKRLGIATAKCWNEVNWLRMKQYKEGKRVDFGITEKAVYEKY
KSVLRVNAQQVARKNAEDWRSFFSLTREKKEGKLPSWFKPRPPGYWKDGRLIVIIRNDRY
TVDERNRVVYLKDFNLSLKFKGRLKWHGKQGRLEIIYDEARKIWYAHIPVEVETEKVKEG
IKASIDLGIVNLATVYVEDGSWYLFKGGSALSHYENYSKRITIVQKTLHRHRQRRSRRLK
LLHEKRSRFLKHALNSMVRRIMEILREKNVGEVVVGYPKEIAKHHGNKLTVNFWNYSYII
KRLEDIGEELGIKVITVDEAYTSKTCSLCGEAHEDGRVKRGLFVCPRTRKAINADLNGAI
NILHIPESRGSEGNFHRGIGVIGLKTQPVTLSDLSKIKNHYNYSISDYTILHYIQP
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaggagtaacactgttaggctagtagtatctaaagagcaacatgaagtgttaaag
aggcttggtatagctacggctaagtgttggaatgaggttaattggttaaggatgaaacag
tacaaggaaggaaagagagtagattttggaattacagagaaggcagtgtatgaaaagtat
aagagtgtgctgagggttaatgcgcaacaagtagctaggaagaacgccgaagattggagg
agcttcttctcattaacccgtgagaagaaagagggaaaactacccagttggtttaaaccg
agaccaccgggttattggaaagatggaagattaatcgtaattatcagaaatgataggtac
actgtggatgaaaggaatagggtggtttatcttaaggattttaatctctcattgaagttt
aagggtaggttaaagtggcatgggaaacagggtaggctggaaataatttacgacgaggcg
agaaagatctggtacgcacatataccagttgaagttgaaactgagaaagttaaggaagga
ataaaggcatctattgatttaggtattgtgaacctagccacggtttatgttgaggacggc
tcgtggtacttattcaaaggtggatctgctttatctcattacgagaactacagtaagaga
attactatagttcagaagactttgcatagacataggcagaggaggagtagaaggcttaag
ttgcttcacgagaagaggagtaggttcctcaaacacgccttgaacagtatggtgaggagg
ataatggaaatactgagggagaaaaacgttggtgaggtggttgtaggttatcctaaagaa
atagctaaacatcatgggaataagctgactgttaacttctggaattattcgtatataata
aagaggcttgaggatattggtgaggagttggggataaaagtaataacagtggacgaggca
tatacttctaaaacgtgttccttgtgtggggaagcccatgaggatggacgtgtgaaaagg
ggattatttgtgtgtccccgcacaaggaaggcaataaatgcggacttaaacggagcaata
aatattctacatatccccgagtcccgaggaagcgagggcaacttccacagagggataggg
gtaattgggctgaagacccagcccgtgacgttgtccgatttgagcaaaattaaaaaccat
tataattacagcatttctgattatactattcttcattatattcagccataa

DBGET integrated database retrieval system