KEGG   Sulfolobus solfataricus P2: SSO1673Help
Entry
SSO1673           CDS       T00054                                 

Definition
hypothetical protein
Orthology
K07076  
 
Organism
sso  Sulfolobus solfataricus P2
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1527105..1527437)
Genome map
AA seq 110 aa AA seqDB search
MGKGKSAIESQIRMLKLAKEIVEEVASSFPNLEEVYIFGSRARGDYLDTSDIDILFVFKG
IKEMNVFDRMYMVSRFIRGNVDYIVLDEGEKDRVKDKVLFWKREKGFVLL
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaagggaaatctgcaatagaaagccagataagaatgcttaaacttgctaaggag
atcgttgaagaggtagctagttctttccccaatctagaggaggtttacatttttgggtca
agagctaggggagactacttagacactagtgatatagacatactgtttgtatttaagggg
attaaggagatgaatgtatttgatagaatgtacatggtttccaggttcattagaggtaat
gttgattatattgtgttggatgagggggagaaagatagggttaaggataaagtgctcttt
tggaagagagagaaaggatttgttttgctctga

DBGET integrated database retrieval system