KEGG   Sulfolobus solfataricus P2: SSO1834Help
Entry
SSO1834           CDS       T00054                                 

Definition
hypothetical protein
Organism
sso  Sulfolobus solfataricus P2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1662175..1662567
Genome map
AA seq 130 aa AA seqDB search
MVSRYYDWLRQAERNLKSAELNFENGIYEETCYEAQQVAEKSVKSLLSYFHKEMRGHSIT
FLLQFSSISIPDWILKCAQELDKNYIPSRYPDVYDQGAPLDYYSKDDATSCLECARKILA
WVKEIVGTSM
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
gtggtaagtagatattatgattggctgaggcaagcagagagaaaccttaagtctgcagaa
ctcaatttcgaaaatggaatttatgaagaaacttgctatgaagcacaacaagttgctgaa
aaatccgttaaatccttgctaagttatttccataaggagatgagaggacactctattact
tttcttttacaattctcatctatatctattcccgactggatattaaaatgtgcacaagag
cttgataagaattatattccttctcgatatcctgatgtgtacgatcaaggggctccatta
gattattacagcaaagatgatgctacgtcttgtttagaatgtgctaggaaaattttagct
tgggtgaaagaaattgttggaacgtctatgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system