KEGG   Sulfolobus solfataricus P2: SSO1914Help
Entry
SSO1914           CDS       T00054                                 

Definition
(GenBank) Hypothetical protein
Organism
sso  Sulfolobus solfataricus P2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1733373..1733786)
Genome map
AA seq 137 aa AA seqDB search
MAIIDTSALFAIYFPEKMTDFIRREIERVEECYFLDLIFYEFPNVIRKRIVRNELSREKA
DEILLRALSYIDLCKIVSGKELTWTAYEISLKYSLTTYDASLIALAKKVGDVILTADEKL
LRGIRNFPEISKYFIFP
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atggctatcattgatacttctgccctatttgcaatttactttccagagaaaatgaccgat
tttataaggagagagattgaaagagttgaggaatgttactttcttgatctaatattttat
gaattccctaacgtaattcgtaaaaggatagtgaggaatgaactaagtagagagaaagca
gatgagatattacttagggctttatcttatattgatctttgtaagatagtaagtggaaag
gaattaacttggactgcttatgagattagcttaaagtatagcttaacaacttatgacgct
tcattaatagctttggcaaagaaagtaggagacgtaatattaactgcagatgaaaaacta
ttaagggggattagaaactttccagaaatctcaaaatatttcatctttccctaa

DBGET integrated database retrieval system