KEGG   Sulfolobus solfataricus P2: SSO1917Help
Entry
SSO1917           CDS       T00054                                 

Definition
hypothetical protein
Organism
sso  Sulfolobus solfataricus P2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1736782..1737102
Genome map
AA seq 106 aa AA seqDB search
MERKWIKKKAHIVPTHAMYGLAQVLKDIGIDVISLVNYALNLHDYHYNGFEPGFSRYSKK
EEVFRDLITLVKETRKVIDIYYSKYEVKEILGKINELIKELTEGNK
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atggaaaggaaatggattaaaaagaaggcccacatagtgcctacacacgccatgtacggt
ttagcacaagtactaaaggatataggaattgacgttataagccttgtgaactatgctcta
aatcttcacgattatcattataatggttttgaacctggctttagtagatatagtaaaaaa
gaggaagtatttagggatttaattacgttagtaaaggagactaggaaagtgatagacatt
tattactctaagtacgaagttaaggaaatattgggaaagattaacgagctaataaaggaa
ttaacagaaggtaataaataa

DBGET integrated database retrieval system