KEGG   Sulfolobus solfataricus P2: SSO1922Help
Entry
SSO1922           CDS       T00054                                 

Definition
hypothetical protein
Organism
sso  Sulfolobus solfataricus P2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1742293..1742688
Genome map
AA seq 131 aa AA seqDB search
MRVIDSSSLVKFFSKEKGWEKVVEIISEGVMTLDLSIKEVANSLWKKILLGEMKEDVVIK
ILSDLLKREALLIVSQDEYLIEAFKIANRNKITVYDSLFIALAKSNNLELVTSDKKQYEV
AIKEGVNTRLI
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
gtgagagtcattgactcttcttctttagtaaaatttttctctaaagagaagggttgggaa
aaggttgtggaaattatatctgaaggagtgatgaccttggacttatcgattaaggaagtt
gctaactccttgtggaaaaagatccttttaggcgaaatgaaagaggacgtcgtaattaaa
atactttctgacttattaaaaagagaggctctattgattgtaagccaagatgaatacttg
attgaggcatttaagatcgctaataggaataaaataactgtttatgactccttgttcatc
gcattagctaagtcgaataaccttgagttagtaacgtctgataaaaagcagtacgaagtt
gcgataaaagaaggagttaatacgcgattaatataa

DBGET integrated database retrieval system