KEGG   Sulfolobus solfataricus P2: SSO1997Help
Entry
SSO1997           CDS       T00054                                 

Definition
hypothetical protein
Organism
sso  Sulfolobus solfataricus P2
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1815967..1816932
Genome map
AA seq 321 aa AA seqDB search
MIGGSGRFLVNLESLNGVESIGNLTKHRTAPVVLKTSTGYLVRYVPVISGEALAHAYQAS
LVDIAKKEGLPVGNLSSQYEFIKFSTDEALKIEGIKEPKDYNDARRFEVEVMLKDVIADV
GGFMYAGSAPVRRTSRIKLGYMIPALRGDEIPAQLEAQFHVRFSNKPVKGSQAIFNVEVS
SALYTFSFELDEDLIAVPSTVGEKVKGEEELERQKARRVDSAIKALYSLLAGNFGGKRSR
FLPSMKLMSLVVVKTDFPFIPEPGHDDSYIKTTVMRLEKAKSVLNGNVAKVYVINNEGIE
VGEGATVLSSVEDLVAKLKEK
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgataggcggttcaggtagatttttagtaaatctggagtcgctgaatggtgttgagagt
atagggaacttaaccaagcacagaaccgctccagttgtgttaaagacttcaaccggttat
ttagtgagatatgttccagtgatttccggagaagccttagctcatgcctatcaagcaagc
ctagtggatatagctaaaaaagagggattgcctgtaggtaatttatcttctcaatacgag
ttcataaagttctcaaccgatgaggcgttaaagattgaagggataaaggaacccaaggat
tataatgatgcgaggaggttcgaggtagaggtgatgcttaaggacgtcattgctgatgtt
ggaggtttcatgtacgctggaagtgctccggtgagaagaacatcaaggataaagttaggt
tatatgataccggctttaaggggagacgaaatacctgcacaactagaagcgcaatttcac
gtgagattctcaaataagcctgttaaaggttctcaagctatcttcaacgtggaagtgtcc
tctgctctctacacgttttcgtttgaacttgacgaagatttgatagcagttccatctact
gtgggggaaaaggttaaaggcgaagaggagttagagaggcaaaaggctcgaagggttgac
tctgcaattaaagccctttactctttgctagcgggtaatttcggagggaagaggtctagg
ttcttaccatccatgaagttgatgtctttagtagtggtgaagactgatttcccattcata
ccggaacctgggcatgacgatagttacattaagaccactgttatgaggttagagaaggct
aaaagtgtgttgaacggaaatgtagctaaggtctatgtgattaacaatgagggtatagaa
gtgggtgaaggagctacagtactgtcaagtgttgaggatttggtagctaaattaaaggaa
aagtag

DBGET integrated database retrieval system