KEGG   Sulfolobus solfataricus P2: SSO1998Help
Entry
SSO1998           CDS       T00054                                 

Definition
hypothetical protein
Organism
sso  Sulfolobus solfataricus P2
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1816948..1817670
Genome map
AA seq 240 aa AA seqDB search
MIYSKVFLKLHWGFSVVKPSAAKAKSGFYLPPPTTLIGALSYGKFRGIDNTNLGKIYGSP
AYNFRNVMATARLESEGAYTEDIVRNVISYFQRKDRRDNPRYIYGVIPTGKVYMPNGTLV
VVYVTDSMSKEELEKLSWSITRIGGKECLVSVENVEIGEAKKVSGRMKTRYYFRDTVKVV
GKKEFLEYVTFWEENGYIWGKEGGPIRYILPVATYPLASKEVEVEAKEAYEVGGEYVVFS
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
ttgatctactctaaggtttttttaaaacttcattggggtttttccgtagttaagccctca
gcagctaaggcaaagtcagggttctatttaccacctcctactacattgattggagcttta
tcctacggtaaatttagggggattgataatactaatttaggcaagatttacggtagtccg
gcgtataattttaggaacgttatggctactgctagattagagtctgagggagcttacact
gaggatattgttagaaacgttatatcttatttccaacgtaaggataggagggataatccg
agatatatttacggagtgatccctactggtaaagtgtatatgcctaacggtacgttagtt
gtcgtctacgtaactgattccatgagcaaggaagagctggaaaaactcagctggagtata
actaggataggaggtaaggagtgtttggtaagtgtggagaacgttgaaattggggaggct
aagaaggtttcaggtaggatgaaaactagatattattttagagatactgtaaaggtagta
ggtaagaaggagtttttggaatatgttactttttgggaagagaacgggtatatatgggga
aaggagggaggaccaataaggtacatcttgccggtggctacctatcccttagctagtaag
gaggttgaagttgaggctaaggaagcatatgaggttggtggagaatatgttgtctttagc
tga

DBGET integrated database retrieval system