KEGG   Sulfolobus solfataricus P2: SSO1999Help
Entry
SSO1999           CDS       T00054                                 

Definition
ATP-dependent RNA helicase-like protein
Orthology
K07012  
CRISPR-associated endonuclease/helicase Cas3 [EC:3.1.-.- 3.6.4.-]
Organism
sso  Sulfolobus solfataricus P2
Brite
Enzymes [BR:sso01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     SSO1999
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     SSO1999
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1817612..1819159
Genome map
AA seq 515 aa AA seqDB search
MKLRLRKHMRLVENMLSLADFYNDFITRHGFEERKGIEETLLNLENGHSVILKAPTGYGK
TTLTMILANAVSSDIDLGSRVIHVLPYRAIVQDLYLKLKNYADRGVIYTKNIGAQDMDYQ
DSPFFMKKVNVTTLDTFILNLFKLPTVDFKLIFKNYGSHYEFPRALIYSSIVIFDEFHLL
GEDGKSLGAGLAALEVLRDAGVPIVVTSATIDKGLERVLMNKLGKNVKVVNADDFKIDRK
IYVNVLENDEISITEEKVKEGKRVLLVYNTRMGAIEAYKKLKGRGLSPILIHSKFSKKDR
IDKVNKINEAKLVVSTQVIEAGIDTSFDVLITEASPSHNLIQRAGRVARYGKGGRGKLEG
EVYIFPFSGKVYDEREVKETVERVRELKTIDENLLIERDYTEVIDSILAKDLSVIDNSVF
VDSKKVKSIYEKICSITRNASIILGFPPNSNDVNDAIPLTEEEAIKIIESKGSSAFVGNG
NVKLYNKKCLQLEMLKNDILGVRIQDYNSEIGGVY
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
ttgaagttgaggctaaggaagcatatgaggttggtggagaatatgttgtctttagctgat
ttctataacgatttcataactcgtcatggctttgaggaaaggaagggtattgaagagact
ttactaaatttggaaaacgggcatagcgttatacttaaggctcccactggttacggtaaa
acaacgttaactatgattttagctaatgccgttagtagtgatattgacctaggtagtagg
gttattcacgtattgccgtatagggctattgtgcaagatttgtatctaaagctgaaaaat
tacgctgatagaggggtaatttacactaagaatattggtgcccaagacatggattatcaa
gattccccttttttcatgaagaaagttaacgttacgactctagataccttcattctcaat
ttgtttaaattacctactgttgattttaagttaatttttaaaaattacggttctcattat
gagttccctagggcgttaatatatagtagtattgtaatatttgatgaatttcacttattg
ggagaggatggtaagagtttaggagctggacttgccgctttagaagttttgagggatgcg
ggtgttccgatagtagttacttcagctacaatagataaggggttggagagggttttgatg
aacaagctgggtaagaatgtaaaggtagttaacgcggatgattttaaaattgatagaaag
atatacgttaacgtattggagaatgatgagatttccattactgaggaaaaggtaaaagag
ggtaagagggttcttttggtttacaatacgagaatgggggcaattgaagcctataagaag
ttaaagggaagggggttatctcctattctaattcacagtaagttcagtaaaaaggatagg
atagataaagtgaacaagataaacgaggcaaagctggtagtttcaactcaagttatagag
gccggtattgatacttcttttgacgttttaataactgaagcttctccctctcataatcta
attcaaagggctggtagggttgcgaggtatgggaagggaggaagagggaaattagagggc
gaggtttacattttcccgtttagtggaaaggtttatgatgagagggaggttaaggagact
gtggaaagggtaagggaactaaagactattgatgagaacttactcattgaaagggattac
acagaggtgattgattcgattctggctaaggatctatctgtaatagataactccgttttc
gtggactctaaaaaggtgaagtcgatatacgagaagatttgttctattactaggaatgca
agtatcatattgggatttccgccaaacagtaatgacgttaatgatgctatacccttaact
gaggaggaggcaattaaaataatagagagtaagggaagttctgcgtttgttgggaatggt
aatgttaaattatataacaagaaatgccttcaattggaaatgttgaagaatgatatttta
ggagttaggattcaagattataatagtgaaataggtggtgtgtattga

DBGET integrated database retrieval system