KEGG   Sulfolobus solfataricus P2: SSO1999Help
Entry
SSO1999           CDS       T00054                                 

Definition
ATP-dependent RNA helicase-like protein
Orthology
K07012  
 
Organism
sso  Sulfolobus solfataricus P2
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1817612..1819159
Genome map
AA seq 515 aa AA seqDB search
MKLRLRKHMRLVENMLSLADFYNDFITRHGFEERKGIEETLLNLENGHSVILKAPTGYGK
TTLTMILANAVSSDIDLGSRVIHVLPYRAIVQDLYLKLKNYADRGVIYTKNIGAQDMDYQ
DSPFFMKKVNVTTLDTFILNLFKLPTVDFKLIFKNYGSHYEFPRALIYSSIVIFDEFHLL
GEDGKSLGAGLAALEVLRDAGVPIVVTSATIDKGLERVLMNKLGKNVKVVNADDFKIDRK
IYVNVLENDEISITEEKVKEGKRVLLVYNTRMGAIEAYKKLKGRGLSPILIHSKFSKKDR
IDKVNKINEAKLVVSTQVIEAGIDTSFDVLITEASPSHNLIQRAGRVARYGKGGRGKLEG
EVYIFPFSGKVYDEREVKETVERVRELKTIDENLLIERDYTEVIDSILAKDLSVIDNSVF
VDSKKVKSIYEKICSITRNASIILGFPPNSNDVNDAIPLTEEEAIKIIESKGSSAFVGNG
NVKLYNKKCLQLEMLKNDILGVRIQDYNSEIGGVY
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
ttgaagttgaggctaaggaagcatatgaggttggtggagaatatgttgtctttagctgat
ttctataacgatttcataactcgtcatggctttgaggaaaggaagggtattgaagagact
ttactaaatttggaaaacgggcatagcgttatacttaaggctcccactggttacggtaaa
acaacgttaactatgattttagctaatgccgttagtagtgatattgacctaggtagtagg
gttattcacgtattgccgtatagggctattgtgcaagatttgtatctaaagctgaaaaat
tacgctgatagaggggtaatttacactaagaatattggtgcccaagacatggattatcaa
gattccccttttttcatgaagaaagttaacgttacgactctagataccttcattctcaat
ttgtttaaattacctactgttgattttaagttaatttttaaaaattacggttctcattat
gagttccctagggcgttaatatatagtagtattgtaatatttgatgaatttcacttattg
ggagaggatggtaagagtttaggagctggacttgccgctttagaagttttgagggatgcg
ggtgttccgatagtagttacttcagctacaatagataaggggttggagagggttttgatg
aacaagctgggtaagaatgtaaaggtagttaacgcggatgattttaaaattgatagaaag
atatacgttaacgtattggagaatgatgagatttccattactgaggaaaaggtaaaagag
ggtaagagggttcttttggtttacaatacgagaatgggggcaattgaagcctataagaag
ttaaagggaagggggttatctcctattctaattcacagtaagttcagtaaaaaggatagg
atagataaagtgaacaagataaacgaggcaaagctggtagtttcaactcaagttatagag
gccggtattgatacttcttttgacgttttaataactgaagcttctccctctcataatcta
attcaaagggctggtagggttgcgaggtatgggaagggaggaagagggaaattagagggc
gaggtttacattttcccgtttagtggaaaggtttatgatgagagggaggttaaggagact
gtggaaagggtaagggaactaaagactattgatgagaacttactcattgaaagggattac
acagaggtgattgattcgattctggctaaggatctatctgtaatagataactccgttttc
gtggactctaaaaaggtgaagtcgatatacgagaagatttgttctattactaggaatgca
agtatcatattgggatttccgccaaacagtaatgacgttaatgatgctatacccttaact
gaggaggaggcaattaaaataatagagagtaagggaagttctgcgtttgttgggaatggt
aatgttaaattatataacaagaaatgccttcaattggaaatgttgaagaatgatatttta
ggagttaggattcaagattataatagtgaaataggtggtgtgtattga

DBGET integrated database retrieval system