KEGG   Sulfolobus solfataricus P2: SSO2036Help
Entry
SSO2036           CDS       T00054                                 

Definition
ATP-dependent RNA helicase
Organism
sso  Sulfolobus solfataricus P2
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1849776..1850858
Genome map
AA seq 360 aa AA seqDB search
MIRISIALLDHQEQLPNMFENLSEDLRKALNEAGYIKPTRVQEVVIPELMNGKSVIVQAK
TGSGKTAAYVIPILERNSTALILSPTRELATQILDEIKKLGKYKQIDVSLIIGGMSYDDQ
RQSKIVVGTPGRLLDLWSKGKIDFSGYDFVIVDEADRMLDMGFIDDIRMILNHCNAKIAG
FFSATIPDEIMTLAKEFSKDLREIVLDEYKPVEEVKQKFVKVRNDWNDKVSKLLEEINGE
KILVFARTRDRARKLYYLLKGKGVNVGLLSGDMPQSVRLKNFYGFKKGKYNVLVATDLAS
RGIDIIDVNKVINFDIPRDVETYIHRVGRTGRMGRVGQAITFYTFREADMIKRINNLLAI
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgattcgaataagcatagctttattagaccatcaagagcagttacccaatatgtttgaa
aatttaagtgaagatctaagaaaggctttgaatgaagccggttacattaaacctaccaga
gtccaagaagttgttattccagaattgatgaacggtaaaagtgtaatagttcaagctaag
accggatctggtaagactgcagcgtatgttattccaattttagaaagaaatagtaccgct
ttaattttatcgcctactagagaattagcaacgcaaattctagatgagataaagaaacta
ggaaaatataaacaaattgacgttagcttgataataggtgggatgagttacgacgatcaa
agacaatccaaaatagtcgttggtaccccaggaagacttttggatctgtggagtaagggc
aagattgacttctctggttacgatttcgttatagttgacgaagcggatagaatgctggat
atgggttttatagatgacattagaatgatattgaatcattgtaatgctaaaattgcaggg
ttcttctcagctacaataccagatgaaattatgacccttgccaaagagttctccaaggat
cttagagagatcgtattggatgaatataaaccggtagaggaggttaaacagaaattcgtg
aaggttaggaatgattggaatgataaagtatcgaaattactggaggaaataaacggtgag
aaaattctggtattcgctaggactagggatagggctaggaaactatactatctgttaaaa
gggaagggagtaaatgtgggacttttaagtggagatatgcctcagagcgttagattaaag
aacttttacgggttcaaaaagggaaagtacaatgttctagttgcaactgatttggcttct
agaggaattgatataatagatgttaacaaggtaataaatttcgatattcccagagacgtg
gagacttacatacatagagtaggaaggactggtagaatgggaagagtgggtcaagcaata
acgttctatacgttcagagaagctgacatgattaaaagaatcaataacttacttgcaatt
tag

DBGET integrated database retrieval system