KEGG   Sulfolobus solfataricus P2: SSO2081Help
Entry
SSO2081           CDS       T00054                                 

Definition
(RefSeq) hypothetical protein
  KO
K19135  
CRISPR-associated protein Csx14
Organism
sso  Sulfolobus solfataricus P2
Brite
Prokaryotic defense system [BR:sso02048]
 CRISPR-Cas system
  Type I CRISPR-Cas system
   Subtype I-U factors
    SSO2081
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1896115..1896651)
Genome map
AA seq 178 aa AA seqDB search
MVKLVATLGTSPGGVIESFLYLVKKGENIDEVRVVTTSNAEVKKAWRIVRLMFVCCIQEK
FPKVEISEHPLDIEDIYSEDDLRKVREFVEKQLGEGDYLDITGGRKSMSVAAALAAKNKG
VKIITSIIPQDDYNKISKKVRELKEIPEIKNRGECRQEMKETYCSLIVQDARSIEFEI
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atggttaaactagtagctacattaggtacatccccgggtggagtaatagaatcttttctt
tacctagtaaaaaagggagaaaacatcgatgaagtaagagtagtgactacatctaatgca
gaagtaaagaaggcatggagaatagtaagattaatgtttgtatgttgtattcaagagaaa
ttccctaaggtagaaattagtgagcatccacttgatattgaagatatttacagtgaagat
gacttaaggaaagttagggaattcgttgaaaaacagttaggtgagggggactatttagat
ataaccggagggaggaagagtatgagtgttgctgccgctttagcagctaaaaataagggg
gtcaaaataataacttcaataatcccacaagacgattacaataagatttccaagaaagta
agggagttaaaggaaatacccgagatcaagaatagaggtgaatgtaggcaagaaatgaag
gaaacctattgcagtttaattgtgcaagacgctagatcaatagaatttgaaatttaa

DBGET integrated database retrieval system