KEGG   Sulfolobus solfataricus P2: SSO2106Help
Entry
SSO2106           CDS       T00054                                 

Definition
(GenBank) Conserved hypothetical protein
Organism
sso  Sulfolobus solfataricus P2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEPN
Motif
Other DBs
NCBI-ProteinID: AAK42285
UniProt: Q7LX90
Position
1928589..1928987
Genome map
AA seq 132 aa AA seqDB search
MILNDMNFTTYRKLLTTAKDYLKASELSFEHNLYEASALNSEISAQLSLIFKLGIEPPRT
HGIRELLSLIYAKLGDKRISDFTKENREKLIILENVRGKSQYGLPPVSRDEAEIALSTAQ
EILKLVESLWNL
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgatattaaatgacatgaacttcacgacttatcggaaactgttgacaacggcaaaggat
tacttaaaagcttccgaactgtcatttgagcacaacctttatgaagcctcagcattaaac
agtgaaatttcagcccaactctccttaattttcaagttaggaatagagcctccccgaact
cacgggattagagagttactttcattaatatacgcgaaacttggagataaaaggataagt
gactttacgaaggagaatagagaaaaactcattattctagagaacgtgagaggaaagtca
cagtacggtttacctccagtgtctagggacgaggctgaaatagctttaagtactgcgcag
gaaatactaaaacttgtagaatcattatggaacctatag

DBGET integrated database retrieval system