KEGG   Sulfolobus solfataricus P2: SSO2106Help
Entry
SSO2106           CDS       T00054                                 

Definition
hypothetical protein
Organism
sso  Sulfolobus solfataricus P2
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1928589..1928987
Genome map
AA seq 132 aa AA seqDB search
MILNDMNFTTYRKLLTTAKDYLKASELSFEHNLYEASALNSEISAQLSLIFKLGIEPPRT
HGIRELLSLIYAKLGDKRISDFTKENREKLIILENVRGKSQYGLPPVSRDEAEIALSTAQ
EILKLVESLWNL
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgatattaaatgacatgaacttcacgacttatcggaaactgttgacaacggcaaaggat
tacttaaaagcttccgaactgtcatttgagcacaacctttatgaagcctcagcattaaac
agtgaaatttcagcccaactctccttaattttcaagttaggaatagagcctccccgaact
cacgggattagagagttactttcattaatatacgcgaaacttggagataaaaggataagt
gactttacgaaggagaatagagaaaaactcattattctagagaacgtgagaggaaagtca
cagtacggtttacctccagtgtctagggacgaggctgaaatagctttaagtactgcgcag
gaaatactaaaacttgtagaatcattatggaacctatag

DBGET integrated database retrieval system