KEGG   Sulfolobus solfataricus P2: SSO2107Help
Entry
SSO2107           CDS       T00054                                 

Definition
hypothetical protein
Orthology
K07076  
 
Organism
sso  Sulfolobus solfataricus P2
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1928975..1929295
Genome map
AA seq 106 aa AA seqDB search
MEPIEKIKLLRNWREALRKLNLERFEEVYVFGSVVSDKITGASDIDLILVIKRGEDRNKA
LIGFFDEVESKLGEKASYLFDVKVIYEDEKELPPYKFFLRDAVRVK
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atggaacctatagagaagataaagttattacgaaactggagggaagcacttagaaagctt
aaccttgaaagatttgaagaagtatatgtgttcggctctgtagtaagcgacaagataact
ggggcaagtgatattgacttaatcttggttattaaacggggtgaagataggaataaagcg
ctaataggcttcttcgatgaggtcgagagcaaactaggggagaaagcatcatatctgttt
gacgttaaagtaatttatgaagatgagaaagaattaccgccatacaagttctttctcaga
gatgcagtgagagtaaaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system