KEGG   Sulfolobus solfataricus P2: SSO2124Help
Entry
SSO2124           CDS       T00054                                 

Definition
second ORF in transposon ISC1316
Orthology
K07496  
putative transposase
Organism
sso  Sulfolobus solfataricus P2
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1948939..1949301
Genome map
AA seq 120 aa AA seqDB search
MGKSLRSLRRRLSDVGFGELRDVLKYQLEKYGKKLILVNPAYTSKTCARCGYVKNDLSLS
DRVFVCPNCGWIADRDYNASLNILKSAGSERSLVPVELRPLPVLWHGRAVKQEAPSFMRG
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
gtgggtaagtccttgaggtctctgaggaggaggctgagtgacgtgggatttggtgagctg
agggatgtgctgaagtatcagctggaaaaatacggaaagaaactcatcctagttaatcct
gcatacacttccaaaacttgtgctaggtgcgggtatgtgaaaaatgacttgtctctatct
gatcgtgttttcgtttgtcccaactgtggttggattgcagatcgtgactataatgcttct
cttaacattttgaagagtgcggggtcggagcgatccttagtgcctgtggagctccgccct
ctaccagtactctggcatggcagagctgtgaagcaggaagctccctcatttatgaggggg
tag

DBGET integrated database retrieval system