KEGG   Sulfolobus solfataricus P2: SSO2441Help
Entry
SSO2441           CDS       T00054                                 

Gene name
adh-7
Definition
(GenBank) Alcohol dehydrogenase (Zn containing) (adh-7)
Organism
sso  Sulfolobus solfataricus P2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C Glu_dehyd_C NAD_binding_7 ApbA Shikimate_DH TrkA_N Sacchrp_dh_NADP 2-Hacid_dh_C Pyr_redox PUA YbjQ_1 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AAK42584
UniProt: Q97W06
Position
2217271..2218257
Genome map
AA seq 328 aa AA seqDB search
MLGAILKNFGEELSLEDVREPSNGIVLKVLATGLCHGDLHVINGDWRYEIKVELPKILGH
EIVGEVVKGNGTFKEGDKVLVYNSIGCGKCKYCASKKYQYCEKVKIIGLNINGGFAEYVS
VPSDNILLRVDGEPVKLAPLADAGITAYSSAKGITNEDSVLIIGTGAVALLALQILKLKG
ARVTVIGHNKNKLEKAKELGADEVINIKYDSTIASEVKESKFDYIIDYVGSDYTLSDSMW
LLNREGELRIIGEFGGTITVPEQLLVLKGLKVRGILYGSFDDLISVYKLYNEGKIRPIVN
TYKLRDINKAIRDLRDGRVIGRAVIVPP
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgctaggtgctattctgaaaaatttcggtgaggagctaagtcttgaagacgtaagagaa
ccttctaacggaattgttctaaaagttctagccactggactttgtcatggagacttacat
gtcataaatggcgattggagatacgaaattaaggtggaattgccgaagatattagggcat
gagatagttggtgaagtcgtcaaaggtaatggtacatttaaagagggagataaggtatta
gtttataatagtattggttgcggaaaatgtaagtattgtgcatcaaaaaagtatcaatac
tgcgaaaaagtgaaaattattgggcttaatattaacggtggtttcgcggaatatgtaagt
gttccttctgataatatcctcttaagagtagatggtgagcccgttaaactggcacctcta
gcagacgctggaatcacagcttatagttcagccaagggtataaccaatgaagatagtgta
ttgattataggaactggggctgtcgcattattagcactacaaattttgaaactaaaagga
gctagagttactgttattgggcataataaaaataagcttgaaaaagctaaagaactagga
gctgatgaggtgattaatataaagtatgatagtacgatagcgagtgaggttaaagaatcc
aagtttgattacattatagattatgtgggcagcgattatacactgtctgattccatgtgg
ttgctaaatagggaaggggagttaagaattattggggaatttggtggtactataactgta
ccggaacaattactagtgttaaaggggttaaaagtaaggggtatattatacggtagcttt
gatgatttgataagtgtttacaaactatataatgagggaaaaattagacctatagtaaat
acgtataaattaagggatattaacaaggcgattagggatttaagagatggtagagtgata
ggtcgtgcagtaatagtacctccttaa

DBGET integrated database retrieval system