KEGG   Sulfolobus solfataricus P2: SSO2494Help
Entry
SSO2494           CDS       T00054                                 

Gene name
adh-8
Definition
(GenBank) Alcohol dehydrogenase (Zn containing) (adh-8)
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
sso  Sulfolobus solfataricus P2
Pathway
sso00010  Glycolysis / Gluconeogenesis
sso00071  Fatty acid degradation
sso00350  Tyrosine metabolism
sso00625  Chloroalkane and chloroalkene degradation
sso00626  Naphthalene degradation
sso01100  Metabolic pathways
sso01110  Biosynthesis of secondary metabolites
sso01120  Microbial metabolism in diverse environments
sso01130  Biosynthesis of antibiotics
sso01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sso00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSO2494 (adh-8)
  Lipid metabolism
   00071 Fatty acid degradation
    SSO2494 (adh-8)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SSO2494 (adh-8)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SSO2494 (adh-8)
   00626 Naphthalene degradation
    SSO2494 (adh-8)
Enzymes [BR:sso01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SSO2494 (adh-8)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 SIS_2 Epimerase THF_DHG_CYH_C ELFV_dehydrog AlaDh_PNT_C adh_short PTS_IIB E1-N Eno-Rase_NADH_b
Motif
Other DBs
NCBI-ProteinID: AAK42630
UniProt: Q97VW0
Position
2264548..2265558
Genome map
AA seq 336 aa AA seqDB search
MKAVILPAHKQGYRIEEVPDPKPGKDEAIIKVNKAALCYRDLLQIKGFYPRSKYPLILGH
EVVGTVEEVGEDVKDFKKGDRVTSMLFVPDWSCEYCKSGEEVYCKNRVVYAQELDGFFAE
KAKVKASSLVKVPESVSDEGAVIVPCVAAMVYRGLKKAGIKKGEIVLVTGASGGVGIHAI
QVAKALGAKVIGVTSGESKAKIVSKYADYVIVGEKFSEEAKKIGDVSIVIENVGPYTLEE
SMKSLRSGGKIIQIGNLDPSVTFNLRLGYIILKDISLMGHIGANKNDIIKTLNLVKEGKI
KPVIGSEVSLENFGKALDLLNDSKNRYGKILISNSF
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgttattcttccagctcataaacaaggttatagaattgaggaagtaccagat
cctaaaccgggtaaggatgaagccattattaaggttaacaaggctgcactgtgttatagg
gacttattgcaaataaaaggattctaccccagatctaaatacccgttaattttaggtcat
gaagttgtgggaactgtagaggaagttggagaagacgttaaggattttaagaaaggggat
agagttacgtcaatgctttttgtccctgactggtcatgtgaatattgtaaaagtggagaa
gaagtttattgtaagaatagggttgtatacgctcaagaattagatggatttttcgcagaa
aaagctaaagttaaggcaagcagtctagttaaagtacctgagagtgtttccgatgaggga
gctgttatagtaccatgtgttgctgcaatggtttataggggtttgaaaaaagctggaata
aaaaaaggagaaattgtattggttactggagcaagtggtggtgtaggtattcatgctatt
caagtagctaaggctttaggggctaaggtaataggagttactagtggggaaagcaaggct
aagatagtttctaaatatgctgactacgtaattgtaggtgagaagttctcagaagaggct
aaaaagataggtgacgtttccattgtaattgaaaatgtgggtccctatacgctagaagaa
agtatgaagagtctgaggagtggcggtaagattatacagatcggtaatttagatccttct
gtaacatttaatttaaggctgggctatattattcttaaagacataagtttaatggggcat
ataggcgcaaataaaaatgatataataaaaactctaaaccttgttaaggagggtaaaata
aaacctgttattggaagtgaggttagcttagagaattttggaaaagctcttgacttgctt
aatgacagtaaaaataggtacggaaaaatattgatctcaaactctttctag

DBGET integrated database retrieval system