KEGG   Sulfolobus solfataricus P2: SSO2529Help
Entry
SSO2529           CDS       T00054                                 

Definition
hypothetical protein
Orthology
K07076  
 
Organism
sso  Sulfolobus solfataricus P2
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2299078..2299446)
Genome map
AA seq 122 aa AA seqDB search
MGKAKSALKSQVELVKVAIEFINDISNEIRIEDVYVVGSRARGDYLETSDIDLVIISRDF
EGLRYIDRLEKLGKHLRARVEFFAFTPEEWKEPKSLLIKEMKKEAKRLEDLAKEIGLSFL
NN
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaggcgaaatctgcattaaaaagtcaagttgaattggtaaaggttgcaatagaa
tttattaatgatataagtaatgaaattagaattgaagatgtgtacgtagtgggttctagg
gccagaggagattacttagagacgagtgacatagatttagtcataatatcacgagacttt
gaaggcttaaggtatattgataggcttgaaaaacttggaaagcacttgagagcacgcgta
gaattctttgcttttacacccgaagaatggaaggagcctaaatctcttttgattaaagaa
atgaaaaaagaagctaagagactagaggatctagcaaaagaaattgggttgtctttttta
aataattag

DBGET integrated database retrieval system