KEGG   Sulfolobus solfataricus P2: SSO2536Help
Entry
SSO2536           CDS       T00054                                 

Gene name
adh-10
Definition
zinc-containing alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sso  Sulfolobus solfataricus P2
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:sso01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sso00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:sso00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:sso00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:sso00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:sso00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
2303254..2304297
Genome map
AA seq 347 aa AA seqDB search
MRAVRLVEIGKPLSLQEIGVPKPKGPQVLIKVEAAGVCHSDVHMRQGRFGNLRIVEDLGV
KLPVTLGHEIAGKIEEVGDEVVGYSKGDLVAVNPWQGEGNCYYCRIGEEHLCDSPRWLGI
NFDGAYAEYVIVPHYKYMYKLRRLNAVEAAPLTCSGITTYRAVRKASLDPTKTLLVVGAG
GGLGTMAVQIAKAVSGATIIGVDVREEAVEAAKRAGADYVINASMQDPLAEIRRITESKG
VDAVIDLNNSEKTLSVYPKALAKQGKYVMVGLFGADLHYHAPLITLSEIQFVGSLVGNQS
DFLGIMRLAEAGKVKPMITKTMKLEEANEAIDNLENFKAIGRQVLIP
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgagagcagttagattagtagaaataggaaaaccccttagcttacaagagataggtgtg
cctaaacccaaaggacctcaagtcttaataaaagtagaggcagcgggagtttgtcattct
gatgtgcacatgagacaaggaaggtttgggaatttaagaatagtggaggatttgggtgta
aaattgcccgtaactttaggtcatgagattgcaggaaaaatagaggaagttggagatgaa
gtagttggatattctaagggggatctagttgcagttaatccttggcagggagaaggaaat
tgctactattgtagaataggagaggagcatctgtgtgactctcctagatggttggggatt
aattttgatggagcttatgcagagtatgtaatagttcctcattataaatatatgtataag
ctgagaagacttaacgctgtagaagcagcaccgttaacttgttctggaataactacatat
agggcagtaagaaaggcatctttagatccaactaagacactactagtagtgggtgctgga
ggaggcttaggcacaatggcagtgcagatagccaaagctgttagtggtgcaacgataata
ggtgtggatgtgagggaagaggcagtggaggctgctaagagagctggagctgactacgta
ataaacgcatcaatgcaagaccccttagcggagataagaaggataactgaaagtaaggga
gtggatgccgtaatagacctgaataactctgagaaaacgctttcagtttaccctaaagct
ttggcaaaacaaggtaaatacgtaatggtgggattgtttggtgcagatttgcattatcat
gcacctctaataactttatcagaaatacaatttgtaggcagtttagttgggaatcaatca
gacttcttggggataatgagattagcagaggctggtaaagtcaaacctatgataactaaa
actatgaaactagaagaggcaaatgaggctattgataatttagagaattttaaggctatt
ggaagacaagtactcataccataa

DBGET integrated database retrieval system