KEGG   Sulfolobus solfataricus P2: SSO2717Help
Entry
SSO2717           CDS       T00054                                 

Gene name
adh-11
Definition
zinc-containing alcohol dehydrogenase (EC:1.1.1.1)
Organism
sso  Sulfolobus solfataricus P2
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2469166..2470119)
Genome map
AA seq 317 aa AA seqDB search
MWKVFFINGNFVKENVRDELPKPNEVKVFPKYIGICGTDKNIYLGKKPVKEPLVLGHEIS
GITEKGEKVAIFPNYWCGYCNNCRRGFYNSCKNKISIGVNADGGMAEYINVPKDFVFRIP
YTLDLKLGALVEPTAVAVAALNKIDKEIEKVIIIGGGSTGTLVSIVAEINGLETFVIEKD
SRKEEILKEKGFRTTKELKFDDRVAVIDTINNQESMVLAQSILKNSIARSELIITGLDNE
QISLNRDIIVRNEVIIRGSIIYSKDDFLNSIKIVSENQEKFNKIVDKVGYIDNINEWFRK
YVIELPNIKVLIKMDSI
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
ttgtggaaggtattttttattaatggaaatttcgttaaagaaaatgttagagatgagctt
cctaaaccgaatgaagtaaaggtttttcctaaatacataggaatatgtggtactgataag
aatatttatttaggtaaaaagccagttaaggaaccacttgtcttaggacatgaaatatcc
gggataactgaaaaaggggagaaggtagctattttcccaaattattggtgcggttactgt
aataattgtagaagaggattttataacagttgtaaaaataaaatatcaattggagttaat
gctgatggcggaatggcggaatatatcaacgtacctaaagatttcgtgtttagaataccc
tacaccttagatttgaaattaggagctttagtagaacctacggcagttgctgttgctgcg
ttaaataagatagacaaagagatagagaaggtaataataataggaggcggtagcactgga
actctggtttcaatagtagctgaaataaatggattagaaactttcgttatagagaaggat
agtagaaaggaagaaatccttaaggagaagggctttagaacaactaaggaattaaaattt
gatgacagagttgcagtgatagatactataaataatcaagagagtatggtactagcccag
tcaattctcaaaaattctatagctagatctgagttaataattaccggattagataatgaa
cagatcagtttaaatagagatattatagttagaaatgaagtaataattagaggttcaata
atatatagtaaagatgattttttaaattccataaagatagttagtgaaaatcaagaaaaa
tttaacaaaatagtggataaggtaggttatatagacaatattaacgagtggttcagaaaa
tatgtaatagaactacctaacataaaagtactaataaaaatggattctatttga

DBGET integrated database retrieval system