KEGG   Sulfolobus solfataricus P2: SSO2785Help
Entry
SSO2785           CDS       T00054                                 

Definition
transposase ISC1316
Orthology
K07496  
putative transposase
Organism
sso  Sulfolobus solfataricus P2
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2542599..2543798)
Genome map
AA seq 399 aa AA seqDB search
MPTLGFRFRAHTDEQTLRALKAQLKLACEVYNTLRWADIYFYQRDGKGLTQTELRQLALD
LRKQDDEYKQVYSQVVQQIADRYYEARQRFFEGLARFPKEKKPHKYYSLVYPQYGWKILQ
VREIRKGSKKKLITLKLSNLGVFKVIVHRDFPLDKVKRVVVKLTRSERIYITFVVEGYEF
PKLPNTGKVVAIDVGVEKLLVTSDSEYFPNLRPLEKALWKVKHLHRELSRKKFLSNNWFK
AKVKLARAYEHLKNLRTDLYMKLGKWFAEHYDVVVMEDIHVKQLIGKSLRSLRRRLSDVA
FSELRDLIKYQLEKYGKKLILVNPAYTSKTCARCGYVKEDLSLSDRVFVCSNCGWIADRD
YNASLNILRGSGSERSLVPVELRPLPVPALRYWHGRAVK
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgcccaccttagggtttcgcttccgtgcacacactgacgaacaaacccttagggcgtta
aaggcccagttgaagttagcatgtgaggtatataacaccttaaggtgggcagacatctat
ttctatcagagggatgggaaaggactaacacaaactgagttaagacagttggctctagat
ctgagaaaacaagatgatgagtataagcaagtctactcgcaagtagttcaacaaatagct
gaccgttactacgaagctagacagaggtttttcgaaggtttagcacgtttcccgaaagaa
aagaaacctcacaaatactactccctagtctatccccagtatggttggaaaatacttcaa
gttagagaaataagaaaaggaagcaagaagaaactaataacgcttaaactatcaaatcta
ggtgtgttcaaggtaatagttcaccgagactttccccttgacaaagtaaagagggtagta
gtgaagctaacaagatctgagaggatttacatcactttcgtagtagaaggttacgaattc
cccaagttacctaacactggtaaggtagtggcgatagatgttggtgtagaaaagttgtta
gtaacgtcagatagtgagtattttcctaatttgagacctcttgaaaaggcgttatggaaa
gtgaagcatctacacagagaactttcaaggaagaaattcctctctaataattggtttaag
gctaaggttaagcttgctagggcttatgagcatttgaagaatctaagaacggatctttac
atgaagttgggtaagtggtttgctgagcattatgacgttgtggtgatggaggacattcat
gttaagcagttgataggtaagtcattaaggtctctgaggaggagattgagtgacgtcgcg
ttcagcgagcttagagatttgattaagtatcagttggagaaatacggtaagaaactcatc
ctggtcaacccagcatacacttccaaaacttgtgctaggtgcgggtacgtaaaagaagat
ctgtctctatctgatcgtgttttcgtttgttccaactgtggttggattgcagatcgtgac
tataatgcttctcttaacatcttacgtggatcggggtcggagcgatccttagtgcctgtg
gagctccgccctctaccagtaccagcacttcggtactggcatggcagagctgtgaagtag

DBGET integrated database retrieval system