KEGG   Sulfolobus solfataricus P2: SSO2878Help
Entry
SSO2878           CDS       T00054                                 

Gene name
adh-13
Definition
zinc-containing alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
sso  Sulfolobus solfataricus P2
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sso00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SSO2878 (adh-13)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSO2878 (adh-13)
  Lipid metabolism
   00071 Fatty acid degradation
    SSO2878 (adh-13)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SSO2878 (adh-13)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SSO2878 (adh-13)
   00626 Naphthalene degradation
    SSO2878 (adh-13)
Enzymes [BR:sso01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SSO2878 (adh-13)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2630800..2631732)
Genome map
AA seq 310 aa AA seqDB search
MKAAILTQFNSPFIIGNAEPHGVGVRINVAYTGICGRDLVIWKGGFKNLKLPLILGHEIV
GYYNGRPVAVYPNLYCGSCDYCKSGKENLCDNARILGEGEITGGYAEQVIVPERNLIPLP
DDKLEKYAATMDPVATAIHASKLADLKKDSKVLVTGAGGGVGIHLVQYLKYLGISNVYGL
SSKGEKLKELGVTPVSDIRGEKFDAIFELVGSKTINDSLRALKKEGILVLIGNTEGEPIT
LSRPAMSIMRQHKIVGSASYTQAEYEEAIKLVGYGKIKAIYEIYELERINEAYRKMLERK
VLGRAILKVI
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcggctattttaacacagtttaactcaccctttataataggtaacgcagagcct
catggagtaggagttagaataaacgtagcgtatactggaatatgtggaagggatctagtt
atatggaagggtggatttaaaaatctcaagctacccttaatcctagggcatgaaatagta
ggttactataatggaagaccagtagctgtttacccaaatctatattgcggaagctgtgac
tattgtaaaagcgggaaggagaatttatgtgataacgctagaattttaggagagggagag
ataactggaggatatgcagagcaggtcattgtcccagaaagaaatctcatacccttgcca
gacgataaactcgaaaaatacgcagctacaatggacccagttgccactgcaattcacgca
tctaaacttgcagatttaaagaaggatagtaaagttttggtaactggggcaggtggagga
gtaggtatccatcttgtacaatacttgaaatatttaggtatatcaaacgtttatgggtta
tcatctaaaggagaaaagcttaaagaattgggggtaacgccagtgagtgatataagaggt
gaaaagtttgatgcaatatttgaactagtgggttctaaaaccataaacgattcgttaagg
gcattaaagaaggaaggtattctagttttgatcggaaatactgaaggggagccgataacg
ctatcaaggccagcaatgagcataatgagacagcataaaatagtaggttctgcatcttat
actcaagcagaatacgaggaagccattaaattggtagggtatgggaaaatcaaagctata
tacgaaatttatgaattagagagaataaatgaggcatataggaaaatgttggagagaaag
gtcttaggaagagctattttaaaggtaatctga

DBGET integrated database retrieval system