KEGG   Sulfolobus solfataricus P2: SSO3003Help
Entry
SSO3003           CDS       T00054                                 

Gene name
dhg-1
Definition
glucose 1-dehydrogenase (EC:1.1.1.47)
Orthology
K18125  
aldose 1-dehydrogenase [NAD(P)+] [EC:1.1.1.359]
Organism
sso  Sulfolobus solfataricus P2
Pathway
Pentose phosphate pathway
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sso00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SSO3003 (dhg-1)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SSO3003 (dhg-1)
   00052 Galactose metabolism
    SSO3003 (dhg-1)
Enzymes [BR:sso01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.359  aldose 1-dehydrogenase [NAD(P)+]
     SSO3003 (dhg-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2743532..2744632)
Genome map
AA seq 366 aa AA seqDB search
MKAIIVKPPNAGVQVKDVDEKKLDSYGKIKIRTIYNGICGTDREIVNGKLTLSTLPKGKD
FLVLGHEAIGVVEESYHGFSQGDLVMPVNRRGCGICRNCLVGRPDFCETGEFGEAGIHKM
DGFMREWWYDDPKYLVKIPKSIEDIGILAQPLADIEKSIEEILEVQKRVPVWTCDDGTLN
CRKVLVVGTGPIGVLFTLLFRTYGLEVWMANRREPTEVEQTVIEETKTNYYNSSNGYDKL
KDSVGKFDVIIDATGADVNILGNVIPLLGRNGVLGLFGFSTSGSVPLDYKTLQEIVHTNK
TIIGLVNGQKPHFQQAVVHLASWKTLYPKAAKMLITKTVSINDEKELLKVLREKEHGEIK
IRILWE
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctataatagtgaaacccccaaacgcgggagtgcaggtaaaggatgttgatgaa
aagaaattggacagctacgggaaaataaagataagaacaatctacaacggtatttgtggt
actgatagagagatagttaatggtaagttaacattgtcgactttacctaagggaaaggat
ttcttggtattgggtcatgaggcaataggtgttgtggaagagtcttatcatggtttttct
caaggagatctggtaatgccagttaataggagaggatgcggtatttgtagaaattgttta
gttgggagaccagacttttgtgaaacaggggaattcggagaagctggaatacacaaaatg
gatgggtttatgagggaatggtggtacgacgaccctaagtatttggttaaaattcctaag
tcaattgaagatattggaattttagcacaaccgttagcagacattgagaagtccattgag
gaaatattggaagttcagaaaagggttccagtgtggacttgtgatgatggaactctaaat
tgtaggaaagttctcgttgttggcaccggaccaattggagtcttatttactttgcttttt
agaacttatggactagaggtttggatggcaaacagaagagaacccactgaggtagaacag
accgttatagaggaaaccaaaactaactattataattcatccaatgggtacgacaaattg
aaagactcagtaggtaagttcgatgtaataatagacgcaacgggagcagatgtaaatata
ttaggtaatgttattccattgttaggaaggaacggagttttaggtctctttggattttca
acttctggttcagttccattggactacaagacattacaagaaatagtacacacaaataag
acgataataggtctagtgaatggtcaaaagccccacttccagcaagccgtagttcattta
gcctcttggaagactttatatcctaaggctgctaagatgctaattactaagactgtcagt
ataaatgatgaaaaagagttacttaaagtgcttagggaaaaggaacatggagaaatcaag
ataagaatattatgggaataa

DBGET integrated database retrieval system