KEGG   Sulfolobus solfataricus P2: SSO3078Help
Entry
SSO3078           CDS       T00054                                 

Definition
hypothetical protein
Orthology
K07064  
 
Organism
sso  Sulfolobus solfataricus P2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2833113..2833517)
Genome map
AA seq 134 aa AA seqDB search
MEKAIVDTNVIIYDYVEDSEYHKRAEELLDSLDRWVIPVIVVHEIMWFLKGMKLEDKVDD
VLAYIRSEKAEVVCDCTDNVTDAIGVLNKEKLPLVSYKDMVILSHAIREKLPLATFDRKL
SKIAKKYSVSLLQS
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
gtggagaaggcaatagttgacactaacgtgataatttacgactacgttgaagactccgaa
tatcataagagggcggaagagcttctcgatagtttggataggtgggtaattcccgtgatt
gtagttcatgagatcatgtggttcttaaagggcatgaaacttgaagacaaggtagatgac
gttttggcttatattagaagtgagaaagctgaggttgtctgcgattgtacagataacgtc
actgacgctataggagtgctgaataaggaaaagcttcccttggtcagctacaaagatatg
gtaatactttctcacgcaattagagaaaaattgcctttagccacttttgataggaaactc
tcaaagatagcaaagaagtactccgtaagtttgctacagtcgtaa

DBGET integrated database retrieval system