KEGG   Sulfolobus solfataricus P2: SSO3204Help
Entry
SSO3204           CDS       T00054                                 

Gene name
dhg-3
Definition
glucose 1-dehydrogenase (EC:1.1.1.47)
Orthology
K18125  
aldose 1-dehydrogenase [NAD(P)+] [EC:1.1.1.359]
Organism
sso  Sulfolobus solfataricus P2
Pathway
Pentose phosphate pathway
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:sso00030]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sso00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2949984..2951066)
Genome map
AA seq 360 aa AA seqDB search
MKAIVVNPPNKGVHVKEINDIHRSLTADEVLVKTIANGICGTDRGIVSGLLKFSRPPNGK
NDLVLGHENLGQVIDKGPEVHGLGKGDYVVSIVRRGCGKCSNCLAGRQDFCETGEFVEAG
IRGLDGFMREFYIDNASYLVKIPDEIVDIAVLLEPLSNVVKAYSELMLVQRRMTWWCKDG
SYNCRNVAIVGSGPIGLMFSLMFSIQGFNAFVLNKRDPFPIEAEIVEKSNAKFINTNKDR
LPNTIDLLIDTSGYPSAFIPLMSRLNKNSAIILFGTTGGEKFEVNADLITYLVENNILLF
GSVNASKKDFENGVNYLTIWKYRYPSVLNRMITRVIKPEQAPEVLYTKPKGEIKTVISWV
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcaatagtagttaatccaccaaacaaaggagtgcatgttaaagagataaacgat
atacatcgatcactcaccgcagatgaagttttagttaaaacgatagcaaatggcatttgt
ggaactgatcgtggtattgtttctggcttattgaaattctctcgaccaccaaatggaaaa
aatgatttagtgttaggacatgaaaatttgggtcaagtgattgataagggaccagaggta
catggcttaggtaaaggcgactacgtagtctcgatagttagaaggggatgtggaaagtgt
tccaattgtttagctggaaggcaagatttttgtgaaactggggaatttgtggaagctgga
attagaggtttagacggttttatgagggaattttatatagataatgcaagctatttagtt
aaaataccagatgaaatagttgatatcgcagttttgcttgagccactttccaatgtggta
aaggcttatagtgagctaatgctagtgcaaagaagaatgacatggtggtgtaaggacggc
agttataattgtagaaatgttgcaatagtaggatctgggccaataggtctcatgttttcc
ttaatgttctctattcaaggttttaatgcatttgttttgaataagagagatccttttcca
attgaggctgagatcgtagagaagagcaatgctaaatttataaatactaataaagatcga
ctacctaatacaatagacttacttatagacacttcagggtatccatcagcgtttattccc
ctaatgagtaggttaaacaagaactcagcaattatactatttggcactaccggtggagag
aaatttgaggttaatgctgatttaataacatatcttgtagaaaataacattttattattt
gggagtgttaatgccagtaagaaggactttgaaaacggtgtgaattatcttacaatctgg
aaatatagatatccaagtgtattaaatagaatgataactagagttattaaaccagagcaa
gctccagaagtattatatacaaaacccaagggagaaataaagacagtaatttcatgggtt
taa

DBGET integrated database retrieval system