KEGG   Sulfolobus solfataricus P2: SSO3217Help
Entry
SSO3217           CDS       T00054                                 

Definition
second ORF in transposon ISC1316
Orthology
K07496  
putative transposase
Organism
sso  Sulfolobus solfataricus P2
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2964929..2965630)
Genome map
AA seq 233 aa AA seqDB search
MVVKLTRSERIYITFVVDHEFPKLPNTGKVVAIDVGVEKLLVTSDGEYFPNLRPYEKALW
KVKHLHRELSRKKFLSNNWFKAKVKLARAYEYLKNLRTDLYMKLGKWFAEHYDVVVMEGI
HAKQLVGKSLRSLRRRLSDVGFGELRDVLKYQLEKYGKKLILVNPAYTSKTCARCGYVKN
DLSLSDRVFVCPNCGWIADRDYNASLNILKGAGSERPLVWSSALYQYSGKVGL
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
gtggtagtgaagctaacaagatctgagaggatatacatcactttcgtagttgatcacgaa
ttccccaagttacctaacactggtaaggtagtggcgatagatgttggtgtagaaaagttg
ttagtaacgtcagatggtgagtattttcctaatttgagaccttacgagaaagctttatgg
aaagtgaagcatcttcatagggagctttcaaggaagaagttcctctctaataattggttt
aaggctaaggttaagcttgctagggcttatgagtatttgaagaatctaagaacggatctt
tacatgaagttgggtaagtggtttgctgagcattatgacgttgtggtgatggagggtatt
cacgctaaacaacttgtgggtaagtccttgaggtctctgaggaggaggctgagtgatgtg
ggatttggtgagttgagggatgtgctgaagtatcagctggaaaaatacggaaagaaactc
atcctagttaatcctgcatacacttccaaaacttgtgctaggtgcgggtatgtgaaaaat
gacttgtctctatctgatcgtgttttcgtttgtcccaactgtggttggattgcagatcgt
gactataatgcttctcttaacattttgaagggtgcggggtcggagcgacccttagtgtgg
agctccgccctctaccagtactctggcaaggtggggctgtga

DBGET integrated database retrieval system