KEGG   Sulfolobus solfataricus P2: SSO3217Help
Entry
SSO3217           CDS       T00054                                 

Definition
second ORF in transposon ISC1316
Orthology
K07496  
putative transposase
Organism
sso  Sulfolobus solfataricus P2
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2964929..2965630)
Genome map
AA seq 233 aa AA seqDB search
MVVKLTRSERIYITFVVDHEFPKLPNTGKVVAIDVGVEKLLVTSDGEYFPNLRPYEKALW
KVKHLHRELSRKKFLSNNWFKAKVKLARAYEYLKNLRTDLYMKLGKWFAEHYDVVVMEGI
HAKQLVGKSLRSLRRRLSDVGFGELRDVLKYQLEKYGKKLILVNPAYTSKTCARCGYVKN
DLSLSDRVFVCPNCGWIADRDYNASLNILKGAGSERPLVWSSALYQYSGKVGL
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
gtggtagtgaagctaacaagatctgagaggatatacatcactttcgtagttgatcacgaa
ttccccaagttacctaacactggtaaggtagtggcgatagatgttggtgtagaaaagttg
ttagtaacgtcagatggtgagtattttcctaatttgagaccttacgagaaagctttatgg
aaagtgaagcatcttcatagggagctttcaaggaagaagttcctctctaataattggttt
aaggctaaggttaagcttgctagggcttatgagtatttgaagaatctaagaacggatctt
tacatgaagttgggtaagtggtttgctgagcattatgacgttgtggtgatggagggtatt
cacgctaaacaacttgtgggtaagtccttgaggtctctgaggaggaggctgagtgatgtg
ggatttggtgagttgagggatgtgctgaagtatcagctggaaaaatacggaaagaaactc
atcctagttaatcctgcatacacttccaaaacttgtgctaggtgcgggtatgtgaaaaat
gacttgtctctatctgatcgtgttttcgtttgtcccaactgtggttggattgcagatcgt
gactataatgcttctcttaacattttgaagggtgcggggtcggagcgacccttagtgtgg
agctccgccctctaccagtactctggcaaggtggggctgtga

DBGET integrated database retrieval system