KEGG   Sulfolobus solfataricus P2: SSO3237Help
Entry
SSO3237           CDS       T00054                                 

Definition
sorbitol dehydrogenase (EC:1.1.1.14)
Orthology
K00008  
L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
sso  Sulfolobus solfataricus P2
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sso00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SSO3237
   00051 Fructose and mannose metabolism
    SSO3237
Enzymes [BR:sso01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     SSO3237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2980572..2981609)
Genome map
AA seq 345 aa AA seqDB search
MVEGFSPMKSVIMENGKAVIKELPLPKLQQGDVLVKMKACGLCGTDIEKICGQYTASQPI
LGHEPTGIIQESTVDWLKPGDRVFAHHHVPCYECYYCKKGSPTMCPYYRKTNLDPGGFSE
YFRVPAWNVARGGVLKLPDNVSFEEGAFIEPLATVIRAQKRVAIDNGDTVFIVGIGPMGL
LHAMMAKVNKAGVIIASDVSDFRTEFGYKVGINYSLNAKKVNVVDEVKRLTDGRGADVTI
IASGSPSAIVSGLNATRKGGRVLLFGVPYKGTILNYDISDLLNNEISIIPSNAAVEEDTK
EALAIIANKKIDVTKLITHRFSLDEFNEAVRIGKEGNAIKVIIYS
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggtggagggattctcacctatgaaaagcgtaattatggagaacggaaaggctgtaata
aaggagctaccattacctaaattacagcaaggtgatgtattagttaaaatgaaggcttgt
ggattgtgcggtactgacatcgagaagatttgtgggcaatacaccgcatcacaaccaata
ttgggtcatgaaccgactggaataatccaagaatctacagtggattggctaaagcctggg
gatagggtctttgctcatcaccatgtcccatgctatgagtgttattattgtaaaaaggga
agcccgaccatgtgtccttattatagaaaaactaacttagatcccggtggattttcggag
tacttcagagtcccagcttggaatgttgcaagagggggagtattaaagttgccagataat
gtaagtttcgaagaaggggcattcatagaaccattagctaccgttattagggcgcaaaag
agagtagctatcgataatggcgatacggtctttattgttggaattggtcccatgggacta
ttacacgcaatgatggctaaggtaaataaggcaggagttatcatagcatcagacgtaagt
gattttagaaccgaatttggatacaaagtaggtattaactattcccttaatgcgaagaaa
gttaatgtagttgatgaagttaagagattaaccgatggtagaggcgctgatgttactata
atagcctctggatctccttctgcaatagtctctggtcttaatgctactagaaagggtggt
agagttttactatttggtgtgccatataaggggacgatacttaattacgatattagtgac
ctcttaaataatgagatctcaataattcctagtaatgctgctgtggaagaggatacaaag
gaagctttagctataatagctaataagaagattgatgtaactaaactgataactcataga
ttctcattagatgagttcaatgaggccgtaaggataggtaaggagggaaatgccataaag
gtaataatatatagttga

DBGET integrated database retrieval system