KEGG   Sulfolobus solfataricus P2: SSO8620Help
Entry
SSO8620           CDS       T00054                                 

Definition
hypothetical protein
Organism
sso  Sulfolobus solfataricus P2
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1511957..1512196
Genome map
AA seq 79 aa AA seqDB search
MEEVKVTRNYQITIPYEIRQKLGIKIGDKLIVTVDGDKIVIEKKKGNISSLNLTLGKKIT
DEEINETINEAGREIADSS
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
atggaagaggttaaggtaacgaggaattatcagattaccataccttatgaaataaggcaa
aaattaggaataaaaataggtgataagctaattgtgacagttgatggagacaaaatagtt
attgaaaagaagaagggaaatatatcttctctaaacttaactttaggtaagaaaataact
gatgaggaaataaatgagacaataaatgaggctggaagagaaattgcagacagtagttga

DBGET integrated database retrieval system