KEGG   Sulfolobus solfataricus P2: SSO9378Help
Entry
SSO9378           CDS       T00054                                 

Definition
hypothetical protein
Organism
sso  Sulfolobus solfataricus P2
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1782833..1783108)
Genome map
AA seq 91 aa AA seqDB search
MSLTLRVEVGKKGYIIIPKSVRDLVGIKEGDILILTVVGDKIILEPERKVNIREVVKKLE
EHERKISYAKRASLGELENISLEEELKIDFS
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
atgagtttgactctaagagtggaagttggaaagaagggttatataataattcctaaaagt
gtaagggatttggtgggaataaaagagggggatatcttaattttgacagtcgttggagat
aagataatcttagaacctgagaggaaggttaacatacgagaagttgtcaaaaaattagaa
gaacatgagaggaagatatcttatgctaaaagggcaagccttggggaacttgagaacata
agtcttgaagaggaattgaagattgatttttcttga

  All links  
No link information was found.   
DBGET integrated database retrieval system