KEGG   Sulfolobus solfataricus P2: SSO0004Help
Entry
SSO0004           CDS       T00054                                 

Gene name
rbsK-1
Definition
ribokinase (rbsK-1) (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
sso  Sulfolobus solfataricus P2
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:sso00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SSO0004 (rbsK-1)
Enzymes [BR:sso01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     SSO0004 (rbsK-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2088..2969
Genome map
AA seq 293 aa AA seqDB search
MIIVVGSYNVDVILKVNKIPEIGETVIADELYITHGGKGSNQAVSASRLGSHVKIIVAVG
DDKHGTDAIEFWKSENIDVSKVKVKSGINTGTAYIFVDKKGRNIIVVNRGANYYLSEDDL
NNSLEGDILLMQLEIRESVVKKAAKEFNGIKILNPAPANLKDTEILSLVDIITPNEIEFK
ELVNTDDFEYGLNLLLKKVKKAVIVTLGERGALLATRDGKKVLIPAPKVNVIDETGAGDV
FNAALSVYLEKGYDLETAVEYANKVAALSVTKIGALGPKLDEVVRFLEEIDKA
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
ttgataatcgtagtaggaagttacaacgttgatgtaatattgaaagttaataaaatacct
gaaattggagaaactgtaatagctgatgaattatacataacgcatggaggtaaaggctca
aatcaggcagtatcagcttcaagattaggaagccatgttaaaataatcgttgcagtggga
gatgataaacatggaactgatgcgatcgaattttggaaatcagaaaatattgacgtatct
aaagtgaaagtaaagagtggtataaacactggaactgcatatatattcgttgacaagaaa
ggaagaaatatcattgttgtaaacagaggtgcaaattactatttgtcagaagacgattta
aataatagcctcgagggtgacatattattaatgcaattggaaataagggaaagtgtagtt
aaaaaggcagcaaaggagtttaacggaataaaaatacttaatcccgccccagctaacctt
aaagatactgaaattttgtcattagtagatattataacacctaatgaaatagagttcaaa
gagttagtaaatactgacgatttcgaatatggtttaaatctattgctaaagaaagtaaaa
aaggcggtgatagttacgctaggggaaagaggagcacttctggcaactagagacggaaaa
aaggtacttataccagctcctaaagtaaatgttatcgatgaaacgggagctggtgacgta
tttaatgcagcgctttccgtgtatttagaaaaggggtatgaccttgagactgcagttgaa
tatgcgaataaggttgcagcgctttccgtaactaagataggagctttaggaccaaaatta
gatgaggtggtgagatttcttgaagaaatcgacaaagcgtaa

DBGET integrated database retrieval system