KEGG   Sulfolobus solfataricus P2: SSO0184Help
Entry
SSO0184           CDS       T00054                                 

Definition
uroporphyrinogen III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
sso  Sulfolobus solfataricus P2
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sso00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SSO0184
Enzymes [BR:sso01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     SSO0184
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
155965..156678
Genome map
AA seq 237 aa AA seqDB search
MRVLFLRPDNEDNELNEKLMILRKNGIEVLNIPIFKIKCVSYSLPTYDYEALAFTSRNSV
ICFKDRTLIKNVHKIYAIGEETAELLMKMYNVNPITPERFTSIELAKRILEDKVNSILSI
RSRKASEDMRNILNGKIKYDEIYVYDSEIIRDNINEISKILTECEVDAIAFTSSLMAKLI
GPFIRGKCNIIIFSIGPMTTETLKRVNNKVKIIESKTHSIKGIIETILVEMKRNGRD
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgagggtattattccttaggcccgataatgaagataatgaactcaatgaaaagcttatg
atacttcggaaaaacggaattgaagttctaaacattcccatctttaaaataaaatgcgtc
tcatattcgttaccgacctatgattatgaggcactagcatttacaagcagaaattcagtc
atttgtttcaaagatcgcaccttaattaaaaacgttcataagatatacgctatcggagaa
gaaactgctgagttattaatgaaaatgtataatgtaaatccgataactccagagagattt
acgagtatagaactagctaaaagaattttggaagataaggtaaatagtatacttagcata
aggagtagaaaagcttctgaagatatgagaaatattcttaatggcaaaattaaatatgat
gagatttacgtatatgattcagaaataatcagagataatataaacgaaatatccaaaatt
ctaaccgaatgtgaagttgacgccatagcatttactagttcgttgatggctaagctaatt
ggtccttttattaggggtaagtgtaatataataatctttagcataggtccaatgacgaca
gaaactttgaaacgagttaataataaggtaaaaataatagaaagcaagacacattctatt
aaaggcattatagaaactattttagtggagatgaaacgaaatggacgagattaa

DBGET integrated database retrieval system