KEGG   Sulfolobus solfataricus P2: SSO0207Help
Entry
SSO0207           CDS       T00054                                 

Gene name
pmM
Definition
phosphomannomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
sso  Sulfolobus solfataricus P2
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sso00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSO0207 (pmM)
   00030 Pentose phosphate pathway
    SSO0207 (pmM)
   00051 Fructose and mannose metabolism
    SSO0207 (pmM)
   00052 Galactose metabolism
    SSO0207 (pmM)
   00500 Starch and sucrose metabolism
    SSO0207 (pmM)
   00520 Amino sugar and nucleotide sugar metabolism
    SSO0207 (pmM)
  Nucleotide metabolism
   00230 Purine metabolism
    SSO0207 (pmM)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SSO0207 (pmM)
Enzymes [BR:sso01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     SSO0207 (pmM)
    5.4.2.8  phosphomannomutase
     SSO0207 (pmM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(178048..179415)
Genome map
AA seq 455 aa AA seqDB search
MGKLFGTDGIRGVTNTELQPEFALKIGKAIGTYFGKGARILIGRDVRAGGDMLLKAVESG
LLSSGVLVYEAGMAPTPAFQYGVKALGYDGGVIITASHNPAEYNGIKVLSPHGIEISRED
EDKIEDIYFNSRFHVVEWNGLVNDVKREDKVIETYLRGILSHVDTEKIKSKKYKVLIDPA
NSVGTLVTPIVARELGCKVFTINGNLDPLFSARTPEPTFESLTESAKVAKQLGVDLAVAH
DGDADRAIFIDSMGRVQWGDRSGTLLSYWASVKAPNLPRRIFTAVSSSSLVEEYLKKYNI
EVKWTKVGSIDIAHMLFKEKGVAGFEENGGFMYPPHQTVRDGAMSFALMLDMMASENESS
AELFNRLPVYYLVKTKVRVTEKSDIKKIYDEVMNKYGNYGNTVTIDGVKIIGSDFWLLVR
KSGTEPIIRILVEAKDENKSKELAKELEKLVSELV
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgggtaagttgtttggaactgatggaataagaggagttaccaatactgaattacaacca
gagtttgcgttaaagattggaaaagctataggaacatattttggtaaaggtgctagaatt
ctaataggtagggatgtaagagcaggaggagatatgctacttaaagctgttgagagtgga
ttgttaagtagtggtgtactggtttatgaagcagggatggctcctactccagctttccaa
tatggtgtgaaggctttaggatatgacggtggtgttataataactgccagtcataatcca
gctgaatataatggtatcaaagtcctttctccacacggtattgagatatctagagaagat
gaggataagatagaagatatatactttaatagcaggtttcatgtggtagagtggaatggt
ttagtaaacgatgtgaaaagagaagacaaggttattgagacttatttaagaggtattctc
tctcatgttgatactgaaaaaattaagagtaaaaagtataaagttctcatagatcctgct
aatagtgtaggtacattagtaacgcccattgttgcaagggagttgggatgtaaagttttt
actattaatgggaatttagatcctttattttcagctagaactcctgaacctactttcgag
agccttaccgaatccgcaaaagttgctaaacaattaggagttgatttagcagtggctcat
gatggtgatgcagatagggcaatttttatagattccatgggtagggtccaatggggtgat
aggagcggtactctattatcatattgggcctcggttaaagctccaaatttacctagacgc
atatttactgcagtttctagctctagcttggttgaggagtatctgaaaaagtataatata
gaggttaagtggactaaggtaggtagcatagatattgcgcatatgttatttaaagaaaaa
ggagtagctggatttgaggaaaatggtgggttcatgtatccccctcatcagacggtaaga
gatggcgcaatgtcgttcgccttaatgctggatatgatggcatctgagaacgaaagttct
gctgagctatttaatagactccccgtttattatttggtaaaaacgaaagttagagttacg
gaaaagagtgatataaagaagatttatgatgaagtaatgaataagtacggaaattacggg
aatactgttacaatagatggtgttaagattataggtagtgatttctggctcttggttagg
aaaagtggtacggagccgataataagaatactagttgaggcaaaagatgagaataaatct
aaagaattagctaaagaattggaaaagttagtgagtgaactagtatga

DBGET integrated database retrieval system