KEGG   Sulfolobus solfataricus P2: SSO0286Help
Entry
SSO0286           CDS       T00054                                 

Definition
(GenBank) Conserved hypothetical protein
  KO
K01622  fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
sso  Sulfolobus solfataricus P2
Pathway
sso00010  Glycolysis / Gluconeogenesis
sso00030  Pentose phosphate pathway
sso00051  Fructose and mannose metabolism
sso00680  Methane metabolism
sso01100  Metabolic pathways
sso01110  Biosynthesis of secondary metabolites
sso01120  Microbial metabolism in diverse environments
sso01130  Biosynthesis of antibiotics
sso01200  Carbon metabolism
sso01230  Biosynthesis of amino acids
Module
sso_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sso00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSO0286
   00030 Pentose phosphate pathway
    SSO0286
   00051 Fructose and mannose metabolism
    SSO0286
  Energy metabolism
   00680 Methane metabolism
    SSO0286
Enzymes [BR:sso01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     SSO0286
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     SSO0286
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_3
Motif
Other DBs
NCBI-ProteinID: AAK40625
UniProt: Q980K6
Position
complement(243568..244716)
Genome map
AA seq 382 aa AA seqDB search
MKTTLSVIKADIGSLAGHHVVHPDTIAAANKILAEAKRNNIISDYYITYVGDDLQLIMTH
NRGELDTRVHETAWNAFKEAAKIAKDLGLYAAGQDLLSDSFSGNLRGMGPGIAEIEFEER
PAEPVVIFMADKTEPGAYNLPLYKIFADPFNTAGLVIDPTMHEGYKFEVLDVYEGESIML
NTPEESYDLLALIGTPSRYIVRRVYRKADNLQASVVSVERLNLIAGKYVGKDDPVMVVRA
QHGLPALGEILEAFTVPYLVPGWMRGSHYGPLMPVSQKDARATRFDGPPRLISLGFNIKN
GKLVGPTDLFDDPAFDEVRRTAVIIADYIRKHGPFMPHRLEPQEMEYTTLPLVIEKLKNR
FKKETDMYKTKPSVYSHESSHE
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactacacttagtgtaatcaaggccgatataggaagcctagctggacatcatgtt
gttcaccctgatactatagctgcagctaacaaaatattggccgaagctaaaaggaataac
ataatttccgattactacataacctatgttggtgatgatttacaattaataatgacacat
aacagaggagaactggatactagagttcatgaaacagcttggaacgcatttaaagaagct
gcaaaaatagctaaggatctaggattatatgctgcaggacaagatttactttcggattct
ttttctggtaatcttagaggtatgggccctggaatcgctgaaatagaatttgaagaaaga
cccgctgaaccagtagttattttcatggctgataaaactgagcctggtgcatataatctt
ccattatataagatatttgcagatccatttaatactgccggactggtaatagatccaact
atgcatgaagggtataaatttgaagttttagatgtatatgaaggagagtcaataatgctg
aacacaccagaggagagttatgatttgcttgcgctaataggaacacctagtagatatata
gtgcgaagagtttataggaaagccgataatttgcaagcatcagttgtctccgtagaaaga
ttgaatctaatagctggaaaatacgtaggtaaagacgatccagttatggtagtaagggct
caacacggtctgcctgcgctaggagaaattttagaagcgtttacagtaccttatttagta
ccagggtggatgagaggcagtcactatggacctcttatgccagtatctcaaaaggatgcg
agggctacaagattcgatggcccacctaggctaataagtttaggatttaacattaaaaat
ggaaaactggtaggtccaactgatttattcgatgatcctgcatttgatgaagttagaaga
acggctgtaataattgcagattacattaggaaacatggcccgtttatgccccatagatta
gagccacaagaaatggagtatactactctaccattagtgatagagaagttaaagaataga
tttaagaaagagacagatatgtataaaactaaaccaagcgtatattcacacgaaagttca
catgaataa

DBGET integrated database retrieval system